KEGG   Sarcophilus harrisii (Tasmanian devil): 100923388Help
Entry
100923388         CDS       T02286                                 

Gene name
PDIA6
Definition
protein disulfide isomerase family A, member 6
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:shr04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 437 aa AA seqDB search
MTGLGFGLISCAFFLGVNGLYSSSDDVIELTPSNFNREVIQSNSLWLIEFYAPWCGHCQR
LAPEWKKAATALKDIVKVGAVDADKHQSLGGQYGVQGFPTIKIFSSNKNRPEDYQGGRTG
EAIVDAALNSLRQLVKERLGGRSGGYSSGRSESSGKKDVIELTDDTFDKNVLDSDDVWLV
EFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATVNQALTSRYGIGGFPTIKIF
QKGEPPMDYNGGRTRSDIVSRALDLFSDNAPPPELLEIVDEAVAKKTCEDHQLCVVAVLP
HILDTGAAGRNSYLEVLLKLAEKYKKKLWGWLWTEAGAQHELETALGIGGFGYPAMAAVN
TRKMKFALLKGSFSEQGINEFLRELSVGRGSTAPVGGGIFPKINTVAPWDGKDGELPIED
DIDLSDVELDDLGKDEL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcctaggattcggactaataagctgtgccttctttttgggtgtgaatggccta
tattcctctagtgatgatgtcatagaacttactccttccaatttcaaccgtgaagttatt
caaagtaacagtttgtggctgatagaattctatgctccatggtgtggtcattgccaaagg
ttagcaccagaatggaagaaagcagctactgcattaaaagatatagtgaaagttggtgca
gttgatgcagataaacatcagtccttaggtggacaatatggagtccaaggattccctact
attaaaatctttagctccaacaaaaatagaccagaagattatcagggtggtagaactggt
gaagctattgtagatgctgctcttaattctttaagacaactggtaaaggaacgccttggt
ggaagaagtggtggatatagttctggtcgaagtgaaagttcaggcaagaaggatgtgatt
gaactgacagatgacacttttgataaaaatgtgcttgacagtgatgatgtttggttggta
gaattttatgccccttggtgtggacactgcaaaaacttagagccagaatgggcagctgca
gccacagaagtaaaagaacagacaaaaggaaaagtgaagctagctgctgtagatgctaca
gtaaatcaggcattgactagccgatatgggattggaggatttcccacaatcaagattttc
cagaaaggagaaccacctatggattacaatggtgggaggacaagatctgacattgtttcc
cgagctctagatttattttctgataatgctccaccacctgaactcctggagattgttgat
gaagcagtagcaaagaaaacatgtgaagatcaccagctctgtgtagttgccgtgttgcct
catattcttgatactggtgcagcaggcagaaattcttacttagaagttctactaaaattg
gcagagaaatacaaaaagaaattgtggggatggctgtggacagaagctggagctcagcat
gagcttgagactgcactgggaattggaggttttgggtaccctgcaatggcagctgtcaat
acacggaaaatgaaatttgctcttttgaaagggtctttcagtgagcaaggaatcaatgaa
tttctcagggagctttctgttggccggggctccacagcaccagtaggtggtggtattttc
cctaaaataaacacagtagccccttgggatggcaaagatggtgagcttcccattgaagat
gatattgatctcagtgatgtagaacttgacgacttgggaaaagatgagttgtga

DBGET integrated database retrieval system