KEGG   Sarcophilus harrisii (Tasmanian devil): 100923582Help
Entry
100923582         CDS       T02286                                 

Gene name
FLNB
Definition
(RefSeq) filamin B
  KO
K04437  
filamin
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100923582 (FLNB)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100923582 (FLNB)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100923582 (FLNB)
  Infectious diseases
   05132 Salmonella infection
    100923582 (FLNB)
Cytoskeleton proteins [BR:shr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100923582 (FLNB)
  Intermediate filaments
   Intermediate filament-binding proteins
    100923582 (FLNB)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100923582 (FLNB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 2535 aa AA seqDB search
SKAIVDGNLKLILGLVWTLILHYSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPI
TNFNQNWQDGKALGALVDSCAPGLCPDWESWDPSKPVDNAREAMQQADDWLGVPQVITPE
EIIHPNVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFT
VDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVAGLHKVTVLFAGQHI
SKSPFEVNVDKAQGDASKVTAKGPGLEATGNIANKATFFDIYTAGAGVGDIEVEVEDPQG
KKTVEMVIEDKGNQVYRCAYKPIQAGPHVVKVSFAGESIPKSPFTVNVGEACNPNACRAS
GRGLQPKGVRIRETADFKVDTKSAGSGELSVTVRGPKGLEELVKQKGFANGVYAFEYYPG
TPGKYVVAITWGGHNIPKSPFEVQVGPEAGVQKVRAWGPGLHGGIAGRSADFVVESIGSE
VGSLGFAIEGPSQAKIEYDDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAYIQP
ASGDFNPDLVQAYGPGLEKTGCIVNNLAEFTVDPKDAGKAPLKIYAQDGEGSPIEIQMKG
KMDGTYACFYTPLKPIKHTISVVWGGVNIPKSPYRVGVGQGSHPQKVKVFGPGVERSGLK
ANEPTHFTVDCTEAGEGDVSVGIKCDAGVLGPDEEDVDFDIIHNANDTFTVKYAPPAPGR
YTIKVLFASKEIPASPFRVKVDPSHDASKVRAEGPGLSKAGVENGKPTHFTVFTKGAGKA
PLDVQFSGPQAGDVVHDLDIIDNYDYSHTVKYTPVQQGSTQVLVTYGGDPIPRSPFVVEV
AAPLDLSKIKLNGLENRVEVGKDQEFVVDTKGAGGQGKLDVTILSPARQVVPCLVASVPG
KDCSTAKYIPKEEGLYAVDVSYDGNPIPGSPFTVEASLPPDPTKVKAHGPGLEAGFVGKP
AEFTIDTKGAGTGGLGLTVEGPCEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHI
PGSPFKADIEMPFDASKVVAXXXXXXXXKVGEAGVLTVDCSEAGRGVLGMEAVSDDGVRA
DVHIQNNKDGTYAVTYVPLAAGMYTLSLNYGGEQVPGFPARVKVEPAVDTSKIKVYGPGI
EGKDVFREATTSFTVDSRPLTKVGGEHVKASIANPSGAFTDYLLKDNADGTYEVEFTPFE
KGFHTVEVTYDDVPVPNSPFQVAVTEGCHPSRVQAQGPGLKEGFTHKPNPFTVVTRGAGI
GGLGITVEGPSESKISCKDNKDGSCSAEYIPFVPGDYDVNITYGNEHVPGSPFRIPVKDV
IDPSKVKLAGPGLGAGVRAKVPQSFTVDTSQAGLAPLEVLVLGPRADEVDSQARRSPLKA
LSDFFRDDQQGDFNETGLVEPVTVTDNGDGTHTVTYTPSQEGPYMLSVKYADEDVPHSPF
KVKVLPTYDASKVTASGPGLSSYGVPASLPVEFAIDAKKAGIGPLAVQITDQEGKPKKAD
VHDNKDGTYSVTYLPDKTGRYLIGVTYGGENIPSSPYRIRATPTGDASKCMATGPGIAPT
VKTGEEVGFVVDAKTAGKGKVTCTILTPDGTEVEAEVIENEDGTYDIFYTAAKPGTYVIY
VRFGGVDIPNSPFTVMATEEDVAVMKEAPVNACPPGYSPWVTEEAYVPVSDMNGLGFKPF
DLVIPFAVRKGEVTGEVHMPSGKTAAPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGNHI
PESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEIS
CIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDNNRRCSQVKLGSAADFL
LDISETDLSTLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGSHVAN
SPVSIMVVQSEIGDARRAKVSGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDI
QTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVKESITRPSRAPS
VATVGSICDLNLKIPEIDSADMSAHVTSPSGRTTEAEIVPVDKSSHCVRFVPQEMGVHTV
SVKYRGQHVTGSPFQFTVGPLGEGGAQKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLS
IAVEGPSKAEIAFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPIIAPSDDA
RRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRF
IPHENGIHTIDVKFNGSHVVGSPFKVRVGDPGQAGNPALVSAYGAGLEGGTTGVQSEFFI
NTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLIGVKYGGPNHIVGSPF
KAKVTGQRLVSPCSANETSSILVESVTRSSTETCYSAVPKASSDASKVTSKGAGLVKAFV
GQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKEKGDYVLAVKW
GEEHIPGSPFHITVP
NT seq 7610 nt NT seq  +upstreamnt  +downstreamnt
atagtaaagctattgttgatggaaacttgaagctcattctgggcctggtatggaccctca
ttcttcactactcaatttctatgcctgtttgggaagatgaaggagatgatgatgctaaga
aacaaactccgaaacagaggctgctgggctggattcaaaacaaaatcccttatttgccca
tcaccaactttaaccagaattggcaagatggcaaagccttgggagccctcgtggatagct
gtgccccaggtctctgccctgactgggaatcttgggatccctcaaagccggtggacaatg
cccgggaagccatgcagcaggccgatgactggttgggggtcccacaggtcatcactcctg
aagaaatcattcaccccaatgtggatgaacactccgtcatgacttacctgtctcagtttc
ccaaagccaaactcaagccgggagcccctctcaaacccaaactcaacccaaagaaggccc
gggcctatggccgaggaattgagcccactggaaacatggtgaagcagccggccaagttta
cggtggacactatcagtgctggacaaggggacgtgatggtttttgtggaagatcctgagg
ggaataaagaggaggcacaagtgactccagacagtgacaagaacaagacttactctgttg
agtatctgcctaaagtcgctggacttcacaaggtcacagttctctttgctggtcagcaca
tctccaagagtccgtttgaggtcaatgttgacaaggcccagggcgatgccagcaaagtga
cagccaaaggaccaggcttggaagccactggcaatattgctaataaggcaactttctttg
acatctacacagcaggagctggtgtgggagacatcgaagtggaggtggaagatccccaag
ggaagaaaacggtagaaatggtcatagaagacaaagggaatcaggtctaccgctgtgcct
acaaacccattcaggctggtccccatgtggtcaaggtctcatttgctggggaatctattc
ccaaaagcccctttaccgtgaatgttggcgaagcctgcaacccgaatgcctgccgggcca
gcggtcggggcctgcagcccaagggcgtgaggatccgcgagacggccgacttcaaggtgg
acacgaagtctgcaggaagcggggagctcagtgtgactgtgcgggggcccaaggggctgg
aggagcttgtcaaacagaagggcttcgcgaacggcgtctatgcctttgagtactacccgg
gaactcctgggaagtacgtggtggccatcacgtggggaggacacaacattccaaagagtc
cctttgaagtccaagtgggccctgaggcaggtgtgcagaaagtcagagcgtgggggcccg
gtctccatggaggcattgccgggaggtcagcggactttgtggtggagtccattggctcgg
aagttggatcattgggatttgccattgaaggcccctcccaggccaagattgaatacgacg
accagaacgatgggtcctgtgacgtgaagtactggcccaaggagcccggggagtacgccg
tgcacatcatgtgcgatgatgaggatatcaaggacagtccctatatggcctacatacagc
ccgcctcaggggacttcaacccagacctggttcaagcctatggcccaggattagagaaga
cgggttgtatcgtcaacaacttggccgaattcaccgtcgatcccaaggatgctgggaagg
cgcccttgaagatctatgctcaggatggagaaggcagtcccattgagattcagatgaagg
gcaagatggacgggacctacgcctgtttttacaccccgctgaagcccataaaacacacca
tttctgtcgtctggggaggagtgaatatccccaaaagcccctacagggttggcgttggtc
aaggcagccaccctcagaaggtcaaggtgtttggccctggagtggaaagaagcggcctca
aagccaacgagcccactcacttcaccgtggactgcaccgaggcaggggaaggcgacgtca
gcgtcggtattaaatgtgacgccggggttctgggcccggatgaagaagacgtggactttg
acatcattcacaacgccaacgacacgttcaccgtgaaatacgcgccgcctgcccctggca
gatacaccatcaaagttctctttgcctccaaggaaatccctgccagtcctttccgagtca
aagttgacccctcccatgatgccagcaaagtcagagccgaaggccccgggctcagtaagg
caggtgtggaaaatggcaagccgactcactttaccgttttcaccaagggggcggggaaag
ccccgctcgatgtgcagttcagcggcccccaggctggggacgtcgtccacgatctggaca
tcatcgacaactatgactattcccacactgtgaagtataccccagtccaacagggcagca
cccaagtcctggtgacctacggcggagatccgatccccagaagcccctttgtggtcgagg
ttgctgctcctttggatctgagcaagataaagctcaatgggctggagaacagagtggagg
ttggcaaagaccaggagtttgtggttgacaccaaaggcgctggggggcagggcaagttgg
acgtgaccattttaagccctgcgcggcaggtggtcccgtgcctcgtggcctccgtgccag
gcaaggactgcagcaccgccaagtacatccccaaggaggagggcttgtacgctgttgacg
tgagctacgatgggaaccccattccaggcagccccttcactgtggaagcctcgctgcccc
cggaccccacaaaggtgaaagcccatggccccggcctggaagccgggtttgtgggaaagc
ctgccgagttcaccatagacaccaaaggagccggtaccgggggcctgggcctgacggttg
aaggcccgtgtgaagccaaaatcgagtgctccgacaatggcgacggcacctgctcagtct
cttacctgccgaccaaacctggcgagtactttgtcaacatcctctttgaagaggtccaca
ttcccggctctccgttcaaagccgacatcgagatgcccttcgatgcctccaaagtggtgg
cnnnnnnnnnnnnnnnnnnnnnnnnnaaagtgggggaggccggcgtcctgaccgtggact
gttcggaggccggccgcggggtcctgggcatggaggccgtgtccgacgatggggtcagag
cggacgtccacatccagaataacaaggacggcacttacgccgtgacctatgtgcccctgg
ctgcgggcatgtacacgctgagcctgaattacggcggagagcaagtgccaggattccctg
cccgggtcaaggtggagcccgccgtggacacgagcaagatcaaggtctatggccctggca
tcgaagggaaagatgtgttccgggaagccacgaccagcttcactgtggactcccgcccgc
tgaccaaggtcgggggagagcacgtcaaagccagcattgccaacccctccggggccttca
cggactacctcctcaaggacaacgccgacggcacctacgaggtggagttcaccccgtttg
agaaaggtttccacacagtggaagtgacatatgacgatgtgcctgtgcccaatagcccct
tccaggtggccgtcaccgagggctgccatccatcgcgagtgcaagcccaaggccctgggc
tgaaggaaggctttacccacaaacccaatcccttcactgtggttaccagaggggcaggaa
tcgggggcctggggatcacggtggaaggaccctccgagtcgaagatcagttgcaaggata
acaaagatggcagctgtagcgcggagtacatcccttttgtgccgggagattatgatgtca
atattacgtacggaaacgagcatgtgcctggcagcccattcaggatccctgtgaaagatg
tcatagaccccagtaaggtcaagcttgcaggccctggcctgggggcaggagtcagagcta
aagtcccacagtccttcactgtggacaccagtcaggctggtctggctcccctggaagtcc
tggtcctgggccccagagcggacgaggtggactcccaggcccggcgcagcccattgaagg
ccttgtcagatttctttagagatgaccagcagggtgactttaatgagacaggcctggtgg
aaccggtgactgtgacggacaacggcgatggcactcacaccgtcacctacaccccctcgc
aggaaggcccgtacatgctgtctgtcaagtacgccgatgaggacgtcccccacagtccct
ttaaggtcaaggtcctccccacgtatgacgctagcaaagtgaccgcaagcggccccggtc
tcagctcctatggggtcccggccagcttgcccgtggagtttgcaatcgatgccaaaaaag
caggaattgggcccctcgctgtccagataacggaccaagaaggaaagcccaaaaaggccg
acgtccacgacaacaaagatggcacctactccgtgacctacctcccagacaagacgggcc
gctatctgatcggggtcacgtacggcggggaaaacatcccgtcttctccttaccgcatcc
gtgcaacgccgactggagacgccagcaagtgcatggccacaggtcctgggatcgcaccca
ctgtcaaaactggagaggaagttggctttgtggtggatgctaagactgcggggaaaggca
aggtgacctgcacgatcctgaccccggacggcacggaagtggaagccgaggtcatcgaga
acgaggatgggacctacgacatcttctacacggcagccaaacccgggacctacgtcatct
atgtgcgctttgggggcgtggatatccccaacagccccttcaccgtcatggccacagagg
aggacgttgccgtaatgaaggaggcgccggtaaatgcatgtccccccggctacagtcctt
gggtgacggaagaagcctacgttcccgtcagtgacatgaatggcctgggatttaagccct
ttgacctggtcattccctttgctgtacggaagggagaagtaaccggggaagtgcacatgc
cctccgggaagacggctgcccccgagatcgtcgacaacaaagatggcaccgtcacggttc
gctacgcgcccaccgaggtcggcctgcacgagatgcacatcaagtacatggggaaccaca
tccccgagagcccgctccagttctatgtgaactacccaaatagcggcagcgtgtcggcgt
acgggcccggcctggtgtacggcgtcgccaacaagacggccaccttcaccatcgtcacag
aggatgcgggagaggggggcctggacctggccatcgaggggccttccaaagctgaaatca
gctgcatcgacaacaaggacggcacctgcacggtgacctacctgcccacactccccgggg
actacagcatcctggtgaagtacaatgacaagcacatacccggcagccccttcaccgcca
agatcacagataacaacaggaggtgttcccaagtgaagctgggctcggctgccgacttcc
tgctggacatcagcgagactgacctgagcacactgaccgccagcatcaaagctccgtccg
ggcgagatgagccttgcctcttgaagaggctcccaaacaaccacattggcatttctttca
tcccccgggaagtcggggaacacctggtcagcattaagaaaaatggcagccacgtggcca
acagcccggtatccatcatggtggttcagtccgagatcggagacgcccggagggccaagg
tctcaggccggggcttgagtgaagggcgcacttttgaaatgtccgacttcattgttgaca
caagggatgcaggttacggtggcatatccctggcggtggaaggccccagcaaggtggaca
tccagacggaagaccttgaagatggcacctgtaaagtgtcctacttccccacggtgccgg
gggtgtatattgtatccaccaagtttgcagatgaacacgtgccagggagtcccttcactg
tgaaaatcagcggagaaggcagggtcaaggaaagcatcacgcgcccaagtcgggcaccgt
cggtggcgaccgttgggagcatctgtgacctcaacctgaaaatcccagaaatagacagtg
cagacatgtcggcccacgtcaccagcccctctggccgcacgacggaggccgagatcgtgc
ccgtagacaagagctcccactgtgtccggttcgtgccccaggagatgggtgtgcacacgg
tgagcgtcaagtaccgagggcagcacgtgaccggaagcccgttccagttcacagttgggc
ccctcggggaagggggtgcccagaaagtccgcgccgggggccccggcctcgagagaggag
aagcgggagtgccagctgaatttagcatttggaccagagaagcaggggccgggggtctct
cgattgctgtcgaaggaccgagtaaggcagaaattgcctttgacgaccacaaaaacgggt
cgtgtggcgtgtcttacattgctcaagaaccgggtaactatgaggtgtcgatcaagttca
acgacgagcacatcccagagagcccctacttggtgcccatcatcgctccttccgacgacg
cccgcagactcactgttatgagccttcaggaatctggattaaaagttaaccagccagcat
cctttgcgataaggctgaatggggccaaaggcaagatcgatgcaaaagtccacagcccct
cgggtgccgtcgaggagtgccacgtgtccgagctggagccagataagtacgccgtgcgct
tcattccccacgagaacggcattcacacgatcgacgtcaagttcaatggcagccacgtgg
ttggaagcccttttaaagttcgagtcggggatccaggacaagcgggaaatccagctctcg
tctctgcctatggagctggcctggaaggggggaccacaggcgtccaatcggagtttttca
tcaataccaccagagctggccccgggacactgtctgttacaattgagggaccgtccaagg
tcaaaatggactgccaggagactccagaaggttacaaagtcatgtatacaccgatggctc
ctgggaattatctgatcggtgtgaaatacggcggacccaaccacatcgttggcagccctt
tcaaggccaaggtgacaggtcaacgcctcgtcagcccgtgctctgccaacgagacatctt
ccatcctggttgagtcggtgaccagatcctccacagaaacctgctacagcgccgtcccca
aagcttcttcagacgccagcaaagtgacttcaaagggagcagggctcgtgaaagctttcg
tgggccagaagagcagcttcctggtcgactgcagcaaggcgggttccaatatgttactga
ttggtgtccatggtcccaccacgccttgtgaagaagtgtccatgaaacatgtaggaaacc
agcagtataatgtgacttatgttgtcaaggagaagggggattatgttttggctgtcaagt
ggggtgaggagcacattccgggaagtcccttccatatcacagtaccttaa

DBGET integrated database retrieval system