KEGG   Sarcophilus harrisii (Tasmanian devil): 100923582Help
Entry
100923582         CDS       T02286                                 

Gene name
FLNB
Definition
filamin B, beta
Orthology
K04437  
filamin
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:shr04010]
Cellular Processes; Cell communication; Focal adhesion [PATH:shr04510]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:shr05205]
Human Diseases; Infectious diseases; Salmonella infection [PATH:shr05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 2535 aa AA seqDB search
SKAIVDGNLKLILGLVWTLILHYSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPI
TNFNQNWQDGKALGALVDSCAPGLCPDWESWDPSKPVDNAREAMQQADDWLGVPQVITPE
EIIHPNVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFT
VDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVAGLHKVTVLFAGQHI
SKSPFEVNVDKAQGDASKVTAKGPGLEATGNIANKATFFDIYTAGAGVGDIEVEVEDPQG
KKTVEMVIEDKGNQVYRCAYKPIQAGPHVVKVSFAGESIPKSPFTVNVGEACNPNACRAS
GRGLQPKGVRIRETADFKVDTKSAGSGELSVTVRGPKGLEELVKQKGFANGVYAFEYYPG
TPGKYVVAITWGGHNIPKSPFEVQVGPEAGVQKVRAWGPGLHGGIAGRSADFVVESIGSE
VGSLGFAIEGPSQAKIEYDDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAYIQP
ASGDFNPDLVQAYGPGLEKTGCIVNNLAEFTVDPKDAGKAPLKIYAQDGEGSPIEIQMKG
KMDGTYACFYTPLKPIKHTISVVWGGVNIPKSPYRVGVGQGSHPQKVKVFGPGVERSGLK
ANEPTHFTVDCTEAGEGDVSVGIKCDAGVLGPDEEDVDFDIIHNANDTFTVKYAPPAPGR
YTIKVLFASKEIPASPFRVKVDPSHDASKVRAEGPGLSKAGVENGKPTHFTVFTKGAGKA
PLDVQFSGPQAGDVVHDLDIIDNYDYSHTVKYTPVQQGSTQVLVTYGGDPIPRSPFVVEV
AAPLDLSKIKLNGLENRVEVGKDQEFVVDTKGAGGQGKLDVTILSPARQVVPCLVASVPG
KDCSTAKYIPKEEGLYAVDVSYDGNPIPGSPFTVEASLPPDPTKVKAHGPGLEAGFVGKP
AEFTIDTKGAGTGGLGLTVEGPCEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHI
PGSPFKADIEMPFDASKVVAXXXXXXXXKVGEAGVLTVDCSEAGRGVLGMEAVSDDGVRA
DVHIQNNKDGTYAVTYVPLAAGMYTLSLNYGGEQVPGFPARVKVEPAVDTSKIKVYGPGI
EGKDVFREATTSFTVDSRPLTKVGGEHVKASIANPSGAFTDYLLKDNADGTYEVEFTPFE
KGFHTVEVTYDDVPVPNSPFQVAVTEGCHPSRVQAQGPGLKEGFTHKPNPFTVVTRGAGI
GGLGITVEGPSESKISCKDNKDGSCSAEYIPFVPGDYDVNITYGNEHVPGSPFRIPVKDV
IDPSKVKLAGPGLGAGVRAKVPQSFTVDTSQAGLAPLEVLVLGPRADEVDSQARRSPLKA
LSDFFRDDQQGDFNETGLVEPVTVTDNGDGTHTVTYTPSQEGPYMLSVKYADEDVPHSPF
KVKVLPTYDASKVTASGPGLSSYGVPASLPVEFAIDAKKAGIGPLAVQITDQEGKPKKAD
VHDNKDGTYSVTYLPDKTGRYLIGVTYGGENIPSSPYRIRATPTGDASKCMATGPGIAPT
VKTGEEVGFVVDAKTAGKGKVTCTILTPDGTEVEAEVIENEDGTYDIFYTAAKPGTYVIY
VRFGGVDIPNSPFTVMATEEDVAVMKEAPVNACPPGYSPWVTEEAYVPVSDMNGLGFKPF
DLVIPFAVRKGEVTGEVHMPSGKTAAPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGNHI
PESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEIS
CIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDNNRRCSQVKLGSAADFL
LDISETDLSTLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGSHVAN
SPVSIMVVQSEIGDARRAKVSGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDI
QTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVKESITRPSRAPS
VATVGSICDLNLKIPEIDSADMSAHVTSPSGRTTEAEIVPVDKSSHCVRFVPQEMGVHTV
SVKYRGQHVTGSPFQFTVGPLGEGGAQKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLS
IAVEGPSKAEIAFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPIIAPSDDA
RRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRF
IPHENGIHTIDVKFNGSHVVGSPFKVRVGDPGQAGNPALVSAYGAGLEGGTTGVQSEFFI
NTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLIGVKYGGPNHIVGSPF
KAKVTGQRLVSPCSANETSSILVESVTRSSTETCYSAVPKASSDASKVTSKGAGLVKAFV
GQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKEKGDYVLAVKW
GEEHIPGSPFHITVP
NT seq 7610 nt NT seq  +upstreamnt  +downstreamnt
atagtaaagctattgttgatggaaacttgaagctcattctgggcctggtatggaccctca
ttcttcactactcaatttctatgcctgtttgggaagatgaaggagatgatgatgctaaga
aacaaactccgaaacagaggctgctgggctggattcaaaacaaaatcccttatttgccca
tcaccaactttaaccagaattggcaagatggcaaagccttgggagccctcgtggatagct
gtgccccaggtctctgccctgactgggaatcttgggatccctcaaagccggtggacaatg
cccgggaagccatgcagcaggccgatgactggttgggggtcccacaggtcatcactcctg
aagaaatcattcaccccaatgtggatgaacactccgtcatgacttacctgtctcagtttc
ccaaagccaaactcaagccgggagcccctctcaaacccaaactcaacccaaagaaggccc
gggcctatggccgaggaattgagcccactggaaacatggtgaagcagccggccaagttta
cggtggacactatcagtgctggacaaggggacgtgatggtttttgtggaagatcctgagg
ggaataaagaggaggcacaagtgactccagacagtgacaagaacaagacttactctgttg
agtatctgcctaaagtcgctggacttcacaaggtcacagttctctttgctggtcagcaca
tctccaagagtccgtttgaggtcaatgttgacaaggcccagggcgatgccagcaaagtga
cagccaaaggaccaggcttggaagccactggcaatattgctaataaggcaactttctttg
acatctacacagcaggagctggtgtgggagacatcgaagtggaggtggaagatccccaag
ggaagaaaacggtagaaatggtcatagaagacaaagggaatcaggtctaccgctgtgcct
acaaacccattcaggctggtccccatgtggtcaaggtctcatttgctggggaatctattc
ccaaaagcccctttaccgtgaatgttggcgaagcctgcaacccgaatgcctgccgggcca
gcggtcggggcctgcagcccaagggcgtgaggatccgcgagacggccgacttcaaggtgg
acacgaagtctgcaggaagcggggagctcagtgtgactgtgcgggggcccaaggggctgg
aggagcttgtcaaacagaagggcttcgcgaacggcgtctatgcctttgagtactacccgg
gaactcctgggaagtacgtggtggccatcacgtggggaggacacaacattccaaagagtc
cctttgaagtccaagtgggccctgaggcaggtgtgcagaaagtcagagcgtgggggcccg
gtctccatggaggcattgccgggaggtcagcggactttgtggtggagtccattggctcgg
aagttggatcattgggatttgccattgaaggcccctcccaggccaagattgaatacgacg
accagaacgatgggtcctgtgacgtgaagtactggcccaaggagcccggggagtacgccg
tgcacatcatgtgcgatgatgaggatatcaaggacagtccctatatggcctacatacagc
ccgcctcaggggacttcaacccagacctggttcaagcctatggcccaggattagagaaga
cgggttgtatcgtcaacaacttggccgaattcaccgtcgatcccaaggatgctgggaagg
cgcccttgaagatctatgctcaggatggagaaggcagtcccattgagattcagatgaagg
gcaagatggacgggacctacgcctgtttttacaccccgctgaagcccataaaacacacca
tttctgtcgtctggggaggagtgaatatccccaaaagcccctacagggttggcgttggtc
aaggcagccaccctcagaaggtcaaggtgtttggccctggagtggaaagaagcggcctca
aagccaacgagcccactcacttcaccgtggactgcaccgaggcaggggaaggcgacgtca
gcgtcggtattaaatgtgacgccggggttctgggcccggatgaagaagacgtggactttg
acatcattcacaacgccaacgacacgttcaccgtgaaatacgcgccgcctgcccctggca
gatacaccatcaaagttctctttgcctccaaggaaatccctgccagtcctttccgagtca
aagttgacccctcccatgatgccagcaaagtcagagccgaaggccccgggctcagtaagg
caggtgtggaaaatggcaagccgactcactttaccgttttcaccaagggggcggggaaag
ccccgctcgatgtgcagttcagcggcccccaggctggggacgtcgtccacgatctggaca
tcatcgacaactatgactattcccacactgtgaagtataccccagtccaacagggcagca
cccaagtcctggtgacctacggcggagatccgatccccagaagcccctttgtggtcgagg
ttgctgctcctttggatctgagcaagataaagctcaatgggctggagaacagagtggagg
ttggcaaagaccaggagtttgtggttgacaccaaaggcgctggggggcagggcaagttgg
acgtgaccattttaagccctgcgcggcaggtggtcccgtgcctcgtggcctccgtgccag
gcaaggactgcagcaccgccaagtacatccccaaggaggagggcttgtacgctgttgacg
tgagctacgatgggaaccccattccaggcagccccttcactgtggaagcctcgctgcccc
cggaccccacaaaggtgaaagcccatggccccggcctggaagccgggtttgtgggaaagc
ctgccgagttcaccatagacaccaaaggagccggtaccgggggcctgggcctgacggttg
aaggcccgtgtgaagccaaaatcgagtgctccgacaatggcgacggcacctgctcagtct
cttacctgccgaccaaacctggcgagtactttgtcaacatcctctttgaagaggtccaca
ttcccggctctccgttcaaagccgacatcgagatgcccttcgatgcctccaaagtggtgg
cnnnnnnnnnnnnnnnnnnnnnnnnnaaagtgggggaggccggcgtcctgaccgtggact
gttcggaggccggccgcggggtcctgggcatggaggccgtgtccgacgatggggtcagag
cggacgtccacatccagaataacaaggacggcacttacgccgtgacctatgtgcccctgg
ctgcgggcatgtacacgctgagcctgaattacggcggagagcaagtgccaggattccctg
cccgggtcaaggtggagcccgccgtggacacgagcaagatcaaggtctatggccctggca
tcgaagggaaagatgtgttccgggaagccacgaccagcttcactgtggactcccgcccgc
tgaccaaggtcgggggagagcacgtcaaagccagcattgccaacccctccggggccttca
cggactacctcctcaaggacaacgccgacggcacctacgaggtggagttcaccccgtttg
agaaaggtttccacacagtggaagtgacatatgacgatgtgcctgtgcccaatagcccct
tccaggtggccgtcaccgagggctgccatccatcgcgagtgcaagcccaaggccctgggc
tgaaggaaggctttacccacaaacccaatcccttcactgtggttaccagaggggcaggaa
tcgggggcctggggatcacggtggaaggaccctccgagtcgaagatcagttgcaaggata
acaaagatggcagctgtagcgcggagtacatcccttttgtgccgggagattatgatgtca
atattacgtacggaaacgagcatgtgcctggcagcccattcaggatccctgtgaaagatg
tcatagaccccagtaaggtcaagcttgcaggccctggcctgggggcaggagtcagagcta
aagtcccacagtccttcactgtggacaccagtcaggctggtctggctcccctggaagtcc
tggtcctgggccccagagcggacgaggtggactcccaggcccggcgcagcccattgaagg
ccttgtcagatttctttagagatgaccagcagggtgactttaatgagacaggcctggtgg
aaccggtgactgtgacggacaacggcgatggcactcacaccgtcacctacaccccctcgc
aggaaggcccgtacatgctgtctgtcaagtacgccgatgaggacgtcccccacagtccct
ttaaggtcaaggtcctccccacgtatgacgctagcaaagtgaccgcaagcggccccggtc
tcagctcctatggggtcccggccagcttgcccgtggagtttgcaatcgatgccaaaaaag
caggaattgggcccctcgctgtccagataacggaccaagaaggaaagcccaaaaaggccg
acgtccacgacaacaaagatggcacctactccgtgacctacctcccagacaagacgggcc
gctatctgatcggggtcacgtacggcggggaaaacatcccgtcttctccttaccgcatcc
gtgcaacgccgactggagacgccagcaagtgcatggccacaggtcctgggatcgcaccca
ctgtcaaaactggagaggaagttggctttgtggtggatgctaagactgcggggaaaggca
aggtgacctgcacgatcctgaccccggacggcacggaagtggaagccgaggtcatcgaga
acgaggatgggacctacgacatcttctacacggcagccaaacccgggacctacgtcatct
atgtgcgctttgggggcgtggatatccccaacagccccttcaccgtcatggccacagagg
aggacgttgccgtaatgaaggaggcgccggtaaatgcatgtccccccggctacagtcctt
gggtgacggaagaagcctacgttcccgtcagtgacatgaatggcctgggatttaagccct
ttgacctggtcattccctttgctgtacggaagggagaagtaaccggggaagtgcacatgc
cctccgggaagacggctgcccccgagatcgtcgacaacaaagatggcaccgtcacggttc
gctacgcgcccaccgaggtcggcctgcacgagatgcacatcaagtacatggggaaccaca
tccccgagagcccgctccagttctatgtgaactacccaaatagcggcagcgtgtcggcgt
acgggcccggcctggtgtacggcgtcgccaacaagacggccaccttcaccatcgtcacag
aggatgcgggagaggggggcctggacctggccatcgaggggccttccaaagctgaaatca
gctgcatcgacaacaaggacggcacctgcacggtgacctacctgcccacactccccgggg
actacagcatcctggtgaagtacaatgacaagcacatacccggcagccccttcaccgcca
agatcacagataacaacaggaggtgttcccaagtgaagctgggctcggctgccgacttcc
tgctggacatcagcgagactgacctgagcacactgaccgccagcatcaaagctccgtccg
ggcgagatgagccttgcctcttgaagaggctcccaaacaaccacattggcatttctttca
tcccccgggaagtcggggaacacctggtcagcattaagaaaaatggcagccacgtggcca
acagcccggtatccatcatggtggttcagtccgagatcggagacgcccggagggccaagg
tctcaggccggggcttgagtgaagggcgcacttttgaaatgtccgacttcattgttgaca
caagggatgcaggttacggtggcatatccctggcggtggaaggccccagcaaggtggaca
tccagacggaagaccttgaagatggcacctgtaaagtgtcctacttccccacggtgccgg
gggtgtatattgtatccaccaagtttgcagatgaacacgtgccagggagtcccttcactg
tgaaaatcagcggagaaggcagggtcaaggaaagcatcacgcgcccaagtcgggcaccgt
cggtggcgaccgttgggagcatctgtgacctcaacctgaaaatcccagaaatagacagtg
cagacatgtcggcccacgtcaccagcccctctggccgcacgacggaggccgagatcgtgc
ccgtagacaagagctcccactgtgtccggttcgtgccccaggagatgggtgtgcacacgg
tgagcgtcaagtaccgagggcagcacgtgaccggaagcccgttccagttcacagttgggc
ccctcggggaagggggtgcccagaaagtccgcgccgggggccccggcctcgagagaggag
aagcgggagtgccagctgaatttagcatttggaccagagaagcaggggccgggggtctct
cgattgctgtcgaaggaccgagtaaggcagaaattgcctttgacgaccacaaaaacgggt
cgtgtggcgtgtcttacattgctcaagaaccgggtaactatgaggtgtcgatcaagttca
acgacgagcacatcccagagagcccctacttggtgcccatcatcgctccttccgacgacg
cccgcagactcactgttatgagccttcaggaatctggattaaaagttaaccagccagcat
cctttgcgataaggctgaatggggccaaaggcaagatcgatgcaaaagtccacagcccct
cgggtgccgtcgaggagtgccacgtgtccgagctggagccagataagtacgccgtgcgct
tcattccccacgagaacggcattcacacgatcgacgtcaagttcaatggcagccacgtgg
ttggaagcccttttaaagttcgagtcggggatccaggacaagcgggaaatccagctctcg
tctctgcctatggagctggcctggaaggggggaccacaggcgtccaatcggagtttttca
tcaataccaccagagctggccccgggacactgtctgttacaattgagggaccgtccaagg
tcaaaatggactgccaggagactccagaaggttacaaagtcatgtatacaccgatggctc
ctgggaattatctgatcggtgtgaaatacggcggacccaaccacatcgttggcagccctt
tcaaggccaaggtgacaggtcaacgcctcgtcagcccgtgctctgccaacgagacatctt
ccatcctggttgagtcggtgaccagatcctccacagaaacctgctacagcgccgtcccca
aagcttcttcagacgccagcaaagtgacttcaaagggagcagggctcgtgaaagctttcg
tgggccagaagagcagcttcctggtcgactgcagcaaggcgggttccaatatgttactga
ttggtgtccatggtcccaccacgccttgtgaagaagtgtccatgaaacatgtaggaaacc
agcagtataatgtgacttatgttgtcaaggagaagggggattatgttttggctgtcaagt
ggggtgaggagcacattccgggaagtcccttccatatcacagtaccttaa

DBGET integrated database retrieval system