KEGG   Sarcophilus harrisii (Tasmanian devil): 100923646Help
Entry
100923646         CDS       T02286                                 

Gene name
NCOA3
Definition
(RefSeq) nuclear receptor coactivator 3
  KO
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Endocrine resistance
Thyroid hormone signaling pathway
Pathways in cancer
Breast cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100923646 (NCOA3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100923646 (NCOA3)
   05224 Breast cancer
    100923646 (NCOA3)
  Drug resistance
   01522 Endocrine resistance
    100923646 (NCOA3)
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100923646 (NCOA3)
Chromosome [BR:shr03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100923646 (NCOA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
1
AA seq 1406 aa AA seqDB search
MVKMSGLGENSLDPLTADSRKRKLPCDTPVQGLTGSGEKWRREQESKYLEELAELISANL
SDIDSFNVKPDKCAILKETVRQIRQIKEQGKATSIDDDVQKADVSSTGQGVIDKDSLGPL
LLQALDGFLFVVNRDGTIVFVSENVTQYLQYKQEDLVNTSVYSILHEDDRKDFLKNLPKS
AVNGDPWTSEAPRQKSHTFNCRMLVKTVHDILDEVGSSPDMRQRYETMQCFALSQPRAMM
EEGEDLQSCMICVARRITTVFPSNPESFITKHDLSGKVVTIDTNSLRSSMRPGFEDIIRR
CIQRFFSLNDGQSWSQKRHYQEAYIQGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTND
RHGFLSTHFLQREQNGYRPNPNPVGQNIRAPTVGCSSSVGGMNMSPNQSLPMQNRPYSLG
DPNAVGQMSGIRYGGPNNMSSINLGPGMQSSPYQNSNYGLNMNSPPHGSPGIGSNQQNLM
ISPRNRGSPKMPSHQFSPVPGMHSPMGSASNTGSNSFSSSSLSALQAISEGVGTSLLSTL
SSPGPKLDNSPNMNMNQQSKIGSQDSKSPAGLYCEQSQVESSICQANSRDHPSDKDSKEI
SVEGPENQRGPPESKGHKKLLQLLTCSSEERGHSTLTNSPLDASCKDSASSVTSPSGVSS
STSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSTTSGEGLVK
QEQLSPKKKENNALLRYLLDRDDPNDSLSKDIKPKVEGGDTKMGQCSTSSISTSSQEKEI
KVKTEQNEEVSGDLDNLDAILGDLTSSDFYNNAMSTNGNNLTNKQQMFQGSTPLGLRSPQ
SMPSARPPFNRAVSLDSPISVGSSPPVRNVNAFPMLPKQPVVSGNTRMMDTQENFGSNMG
GPNRNMTMNHHPSGEWGLPNSKVSRMEQNTSSLVRPGTDYSNSLPRPTMGGTLPGLPVRS
NSIPGTRPMLQQQMIHMRPNEIPMGMGVNAYGQTGTSNQPGSWPDNMLSMDQGPRGTQNR
ALVRNSLDDLLCPPSNIEGQSDERALLDQLHTLLSNTDVTGLEEIDKALGIPDLVNQGQA
LEAKQESFQSQESAVMIDQKSALYGQSYQAQSAVIQGGFSNLQGQQQSFNSMMNQMTQQG
NFPLQGMHPRANMMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALEMKMETAPASGAAVM
RPVMQAQVNSQQGFLNAQMVAQRSRELISHHIRQHRMAMMMQQQQQQQQQQQQQQQQQTQ
TFSPPPNVTASASMDGALAGTSMPQAPPQQFSYPPNYGMSQQSDPAFSRVSSPPSAMMSS
RIGASQNPMMQHPQTAPMYQSPEMKGWPSGTLSRNSSFPQQQFPPQGSPAPYGMMHMNGN
SGHIGQINMNSMPMSGMPMGPDQKYC
NT seq 4221 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaaatgagtggattaggggaaaactccttagacccgctgactgctgattcccga
aagcgtaaattgccatgtgatactccagtacaaggtctgactggcagtggtgagaaatgg
cgacgggagcaagagagtaaatacctcgaggaattggctgagttgatatctgctaatctc
agtgacattgatagtttcaatgtcaaaccagataaatgtgcaattttaaaggaaacagtg
cgacagattcgacagataaaggaacaaggaaaggcaacttccattgatgatgatgttcag
aaagctgatgtatcttccacagggcagggtgttattgataaagattccttaggaccactt
ttactgcaggccttggatggttttctctttgtggttaatcgtgatgggaccattgtgttt
gtgtcagaaaatgtcacacaatacctgcagtataagcaagaagacttggttaacaccagt
gtgtatagtatcctgcatgaagatgacaggaaggattttctcaagaatttgcctaagtca
gcagttaatggagatccatggacaagtgaagcaccaagacaaaaaagtcacacgtttaat
tgccgtatgttggtgaaaacagtgcatgatattttagatgaagtaggaagcagtcctgat
atgcgccagagatatgagacaatgcagtgttttgccttgtctcaaccccgagctatgatg
gaagaaggagaagatttacaatcttgtatgatctgcgtggcacgtcgcattactacagtg
tttccttcaaaccctgaaagctttattactaaacatgatctttcaggcaaagttgtcact
atagatacaaactcactgaggtcttctatgagacctggctttgaagatataatcagaagg
tgtatccagagattttttagtcttaatgatggacagtcatggtcccaaaaacggcactac
caggaagcttatattcaaggacatgctgaaactcctgtgtatcggttctccttagctgat
ggaactatagtgactgcccaaacaaagagcaaactttttcggaatccagtaactaatgat
cgccatggctttctttctacccacttcttacagagagaacaaaatggatatagaccaaat
cccaacccagtgggacaaaacatacgagctcccacagttggctgttccagttctgttgga
ggaatgaatatgtcaccaaatcaaagcctgccaatgcagaataggccctactccctggga
gatcccaatgcagtgggacagatgagtggcattagatatgggggccctaataacatgagc
tctataaatcttggtccaggaatgcaatcctctccctatcagaacagcaattatgggcta
aatatgaatagccccccacatggtagccctggcattggctccaatcagcagaacctaatg
atttctcctcgtaacagaggtagtccaaagatgccttcacatcagttttctcctgttcca
ggtatgcattctccaatgggatctgccagcaatactgggagcaacagtttctccagcagc
tctctcagtgcccttcaagctatcagtgagggtgtggggacttctcttttgtctacactt
tcttcaccgggccccaagttggacaattctccaaacatgaacatgaaccaacaaagtaaa
attggcagccaggattctaagagtcccgctggcttatactgtgaacagagtcaggtggaa
agttccatctgccaagccaatagcagggaccaccctagtgataaagacagtaaagaaatt
agtgttgaagggccagagaaccagaggggaccacctgaaagcaaaggccataagaaatta
cttcagttactgacatgctcttcagaagagcgaggacattccactctgacaaattctcca
ttagatgcaagctgtaaagactctgcttctagtgtcactagcccttctggagtttcctcg
tctacatcgggaggagtttcttccacgtcaaatatgcatggctccctgctgcaagagaag
cataggattttgcacaaattgctacagaatgggaattctcctgctgaagtagccaaaatt
acagctgaagctactgggaaagatacaagcagtacaacttctggtgaaggactagtaaag
caggagcagctaagtcccaagaagaaggaaaacaatgcacttcttcgatatctgcttgat
agagatgatcctaatgattcactttctaaagacataaaacccaaagtggaaggtggagat
acgaaaatggggcagtgcagcacctcttctatttcaacttcaagtcaagaaaaagagatt
aaagttaagactgaacaaaatgaagaggtgagtggagacttggataatttagatgcaatt
cttggtgatctgacaagttctgacttttataacaatgccatgtctacaaatggtaataac
ctgacaaataagcaacagatgtttcaaggaagtactcctctaggtttgagaagcccacag
tctatgccatctgctcgtcctccttttaatcgagctgtttccttggatagtcctatttct
gttggttcaagccctccagtgagaaatgttaatgcatttcccatgttaccaaagcagcct
gtggtaagcggaaatacaaggatgatggatacacaggagaattttggctctaacatgggt
ggaccgaatagaaatatgactatgaaccatcatccctcaggagagtggggtttgccaaat
tctaaagttagtagaatggaacaaaatacaagttcattagtgaggccaggaaccgactat
agtaattccttacccagacctacaatgggtggaactttgcctggccttcctgttaggtcc
aatagtatacctggtacaaggccaatgctacagcagcagatgattcatatgaggcctaat
gagattcctatgggcatgggagtaaatgcctatggccagacaggaacctctaatcaacct
ggatcttggcctgataatatgttatcaatggatcaaggccctcgtgggacacaaaataga
gcccttgttaggaattccttagatgatctcttatgtcctccttctaacatagaaggccag
agtgatgaaagagctcttttggatcagttacatactctgcttagtaacacagatgtcaca
ggacttgaagaaattgataaagctttaggaatccctgatcttgtaaatcaaggacaagct
ttggaagctaaacaggagtcttttcaaagtcaagaatctgcagtaatgattgaccagaag
tctgctctatatggacagtcctatcaagcccagtctgcagtaatacaaggaggtttcagt
aatcttcagggacaacagcaatcgtttaattcaatgatgaatcaaatgacccaacagggt
aactttccactacagggaatgcatccgagagctaacatgatgagaccccgaacaaataca
cccaaacaacttagaatgcaactccaacagagactccagggccagcagtttttgaaccag
agccggcaggctcttgaaatgaaaatggaaaccgcacctgctagtggagctgcagtgatg
aggcctgtaatgcaggctcaagtaaactctcagcagggttttctcaatgcccagatggta
gcccaacgcagcagagagctaattagtcatcacatcagacagcaccggatggcaatgatg
atgcagcagcagcagcagcagcagcaacagcagcagcagcagcaacagcaacagacacag
accttcagccctccccctaatgtgactgcttcagctagcatggatggtgctttggctggg
acctcgatgccacaagctcctccacaacagttttcatacccaccaaattatggaatgagc
caacaatcagatcctgcttttagcagagtatctagtcctcccagtgcaatgatgtcatca
agaattggtgcctcccagaaccccatgatgcagcatcctcagactgcaccaatgtatcag
tcccccgaaatgaagggctggccatcaggaaccttgtccaggaacagttcatttccacag
cagcagtttcccccccaaggtagtcctgctccttatggtatgatgcacatgaatggtaac
agtggccacattggacaaataaacatgaattctatgcccatgtctgggatgcccatgggt
ccggatcagaaatactgctga

DBGET integrated database retrieval system