KEGG   Sarcophilus harrisii (Tasmanian devil): 100923646Help
Entry
100923646         CDS       T02286                                 

Gene name
NCOA3
Definition
nuclear receptor coactivator 3
Orthology
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:shr00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100923646 (NCOA3)
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100923646 (NCOA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 1403 aa AA seqDB search
MSGLGENSLDPLTADSRKRKLPCDTPVQGLTGSGEKWRREQESKYLEELAELISANLSDI
DSFNVKPDKCAILKETVRQIRQIKEQGKATSIDDDVQKADVSSTGQGVIDKDSLGPLLLQ
ALDGFLFVVNRDGTIVFVSENVTQYLQYKQEDLVNTSVYSILHEDDRKDFLKNLPKSAVN
GDPWTSEAPRQKSHTFNCRMLVKTVHDILDEVGSSPDMRQRYETMQCFALSQPRAMMEEG
EDLQSCMICVARRITTVFPSNPESFITKHDLSGKVVTIDTNSLRSSMRPGFEDIIRRCIQ
RFFSLNDGQSWSQKRHYQEAYIQGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDRHG
FLSTHFLQREQNGYRPNPNPVGQNIRAPTVGCSSSVGGMNMSPNQSLPMQNRPYSLGDPN
AVGQMSGIRYGGPNNMSSINLGPGMQSSPYQNSNYGLNMNSPPHGSPGIGSNQQNLMISP
RNRGSPKMPSHQFSPVPGMHSPMGSASNTGSNSFSSSSLSALQAISEGVGTSLLSTLSSP
GPKLDNSPNMNMNQQSKIGSQDSKSPAGLYCEQSQVESSICQANSRDHPSDKDSKEISVE
GPENQRGPPESKGHKKLLQLLTCSSEERGHSTLTNSPLDASCKDSASSVTSPSGVSSSTS
GGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSTTSGEGLVKQEQ
LSPKKKENNALLRYLLDRDDPNDSLSKDIKPKVEGGDTKMGQCSTSSISTSSQEKEIKVK
TEQNEEVSGDLDNLDAILGDLTSSDFYNNAMSTNGNNLTNKQQMFQGSTPLGLRSPQSMP
SARPPFNRAVSLDSPISVGSSPPVRNVNAFPMLPKQPVVSGNTRMMDTQENFGSNMGGPN
RNMTMNHHPSGEWGLPNSKVSRMEQNTSSLVRPGTDYSNSLPRPTMGGTLPGLPVRSNSI
PGTRPMLQQQMIHMRPNEIPMGMGVNAYGQTGTSNQPGSWPDNMLSMDQGPRGTQNRALV
RNSLDDLLCPPSNIEGQSDERALLDQLHTLLSNTDVTGLEEIDKALGIPDLVNQGQALEA
KQESFQSQESAVMIDQKSALYGQSYQAQSAVIQGGFSNLQGQQQSFNSMMNQMTQQGNFP
LQGMHPRANMMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALEMKMETAPASGAAVMRPV
MQAQVNSQQGFLNAQMVAQRSRELISHHIRQHRMAMMMQQQQQQQQQQQQQQQQQTQTFS
PPPNVTASASMDGALAGTSMPQAPPQQFSYPPNYGMSQQSDPAFSRVSSPPSAMMSSRIG
ASQNPMMQHPQTAPMYQSPEMKGWPSGTLSRNSSFPQQQFPPQGSPAPYGMMHMNGNSGH
IGQINMNSMPMSGMPMGPDQKYC
NT seq 4212 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattaggggaaaactccttagacccgctgactgctgattcccgaaagcgtaaa
ttgccatgtgatactccagtacaaggtctgactggcagtggtgagaaatggcgacgggag
caagagagtaaatacctcgaggaattggctgagttgatatctgctaatctcagtgacatt
gatagtttcaatgtcaaaccagataaatgtgcaattttaaaggaaacagtgcgacagatt
cgacagataaaggaacaaggaaaggcaacttccattgatgatgatgttcagaaagctgat
gtatcttccacagggcagggtgttattgataaagattccttaggaccacttttactgcag
gccttggatggttttctctttgtggttaatcgtgatgggaccattgtgtttgtgtcagaa
aatgtcacacaatacctgcagtataagcaagaagacttggttaacaccagtgtgtatagt
atcctgcatgaagatgacaggaaggattttctcaagaatttgcctaagtcagcagttaat
ggagatccatggacaagtgaagcaccaagacaaaaaagtcacacgtttaattgccgtatg
ttggtgaaaacagtgcatgatattttagatgaagtaggaagcagtcctgatatgcgccag
agatatgagacaatgcagtgttttgccttgtctcaaccccgagctatgatggaagaagga
gaagatttacaatcttgtatgatctgcgtggcacgtcgcattactacagtgtttccttca
aaccctgaaagctttattactaaacatgatctttcaggcaaagttgtcactatagataca
aactcactgaggtcttctatgagacctggctttgaagatataatcagaaggtgtatccag
agattttttagtcttaatgatggacagtcatggtcccaaaaacggcactaccaggaagct
tatattcaaggacatgctgaaactcctgtgtatcggttctccttagctgatggaactata
gtgactgcccaaacaaagagcaaactttttcggaatccagtaactaatgatcgccatggc
tttctttctacccacttcttacagagagaacaaaatggatatagaccaaatcccaaccca
gtgggacaaaacatacgagctcccacagttggctgttccagttctgttggaggaatgaat
atgtcaccaaatcaaagcctgccaatgcagaataggccctactccctgggagatcccaat
gcagtgggacagatgagtggcattagatatgggggccctaataacatgagctctataaat
cttggtccaggaatgcaatcctctccctatcagaacagcaattatgggctaaatatgaat
agccccccacatggtagccctggcattggctccaatcagcagaacctaatgatttctcct
cgtaacagaggtagtccaaagatgccttcacatcagttttctcctgttccaggtatgcat
tctccaatgggatctgccagcaatactgggagcaacagtttctccagcagctctctcagt
gcccttcaagctatcagtgagggtgtggggacttctcttttgtctacactttcttcaccg
ggccccaagttggacaattctccaaacatgaacatgaaccaacaaagtaaaattggcagc
caggattctaagagtcccgctggcttatactgtgaacagagtcaggtggaaagttccatc
tgccaagccaatagcagggaccaccctagtgataaagacagtaaagaaattagtgttgaa
gggccagagaaccagaggggaccacctgaaagcaaaggccataagaaattacttcagtta
ctgacatgctcttcagaagagcgaggacattccactctgacaaattctccattagatgca
agctgtaaagactctgcttctagtgtcactagcccttctggagtttcctcgtctacatcg
ggaggagtttcttccacgtcaaatatgcatggctccctgctgcaagagaagcataggatt
ttgcacaaattgctacagaatgggaattctcctgctgaagtagccaaaattacagctgaa
gctactgggaaagatacaagcagtacaacttctggtgaaggactagtaaagcaggagcag
ctaagtcccaagaagaaggaaaacaatgcacttcttcgatatctgcttgatagagatgat
cctaatgattcactttctaaagacataaaacccaaagtggaaggtggagatacgaaaatg
gggcagtgcagcacctcttctatttcaacttcaagtcaagaaaaagagattaaagttaag
actgaacaaaatgaagaggtgagtggagacttggataatttagatgcaattcttggtgat
ctgacaagttctgacttttataacaatgccatgtctacaaatggtaataacctgacaaat
aagcaacagatgtttcaaggaagtactcctctaggtttgagaagcccacagtctatgcca
tctgctcgtcctccttttaatcgagctgtttccttggatagtcctatttctgttggttca
agccctccagtgagaaatgttaatgcatttcccatgttaccaaagcagcctgtggtaagc
ggaaatacaaggatgatggatacacaggagaattttggctctaacatgggtggaccgaat
agaaatatgactatgaaccatcatccctcaggagagtggggtttgccaaattctaaagtt
agtagaatggaacaaaatacaagttcattagtgaggccaggaaccgactatagtaattcc
ttacccagacctacaatgggtggaactttgcctggccttcctgttaggtccaatagtata
cctggtacaaggccaatgctacagcagcagatgattcatatgaggcctaatgagattcct
atgggcatgggagtaaatgcctatggccagacaggaacctctaatcaacctggatcttgg
cctgataatatgttatcaatggatcaaggccctcgtgggacacaaaatagagcccttgtt
aggaattccttagatgatctcttatgtcctccttctaacatagaaggccagagtgatgaa
agagctcttttggatcagttacatactctgcttagtaacacagatgtcacaggacttgaa
gaaattgataaagctttaggaatccctgatcttgtaaatcaaggacaagctttggaagct
aaacaggagtcttttcaaagtcaagaatctgcagtaatgattgaccagaagtctgctcta
tatggacagtcctatcaagcccagtctgcagtaatacaaggaggtttcagtaatcttcag
ggacaacagcaatcgtttaattcaatgatgaatcaaatgacccaacagggtaactttcca
ctacagggaatgcatccgagagctaacatgatgagaccccgaacaaatacacccaaacaa
cttagaatgcaactccaacagagactccagggccagcagtttttgaaccagagccggcag
gctcttgaaatgaaaatggaaaccgcacctgctagtggagctgcagtgatgaggcctgta
atgcaggctcaagtaaactctcagcagggttttctcaatgcccagatggtagcccaacgc
agcagagagctaattagtcatcacatcagacagcaccggatggcaatgatgatgcagcag
cagcagcagcagcagcaacagcagcagcagcagcaacagcaacagacacagaccttcagc
cctccccctaatgtgactgcttcagctagcatggatggtgctttggctgggacctcgatg
ccacaagctcctccacaacagttttcatacccaccaaattatggaatgagccaacaatca
gatcctgcttttagcagagtatctagtcctcccagtgcaatgatgtcatcaagaattggt
gcctcccagaaccccatgatgcagcatcctcagactgcaccaatgtatcagtcccccgaa
atgaagggctggccatcaggaaccttgtccaggaacagttcatttccacagcagcagttt
cccccccaaggtagtcctgctccttatggtatgatgcacatgaatggtaacagtggccac
attggacaaataaacatgaattctatgcccatgtctgggatgcccatgggtccggatcag
aaatactgctga

DBGET integrated database retrieval system