KEGG   Sarcophilus harrisii (Tasmanian devil): 100923766Help
Entry
100923766         CDS       T02286                                 

Definition
(RefSeq) protein-arginine deiminase type-1
  KO
K01481  protein-arginine deiminase [EC:3.5.3.15]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     100923766
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAD PAD_M PAD_N
Motif
Other DBs
NCBI-GeneID: 100923766
NCBI-ProteinID: XP_023355695
Ensembl: ENSSHAG00000003494
Position
3
AA seq 664 aa AA seqDB search
MAQQRAIRLSLQKPTHAVCVVGTEVALDVYGSVPPRAVTFKVTGSSSVQIYMEYDPKNVS
EPPADERWPLDADVDVVLSVEAASTNVDDVKVRVSYYGKNGSQALGQALLHLTAIEVSLD
VDTGRTGTIKRNKDDKKTWSWGPEGRGAILLVNCDRDSHLPGGVDYSHSRLYSLADLQDM
SKMVLWTNGPDKIFDNHKLVLHVSHNDSDKVRVFHAQGGNRVSDYKRVLGPDKLSYSVDR
GPGEQEITFYVEGLAFPDADFFGLVSFDITLMDTDGLLETPIFTDTVVFRVAPWIMTPNT
QTPLDVYVCSLVERESFQAEFLDAMTYLTLKAKCQLIICPLVDNRNDRWIQDELEFGYIE
APHKAFPVVFDSPRNRGLKEFPFKRILGPDFGYVTREPAHGGVSSLDSFGNLDVSPPVTV
QGKEYPLGRILIGSSFPKSGGRRMAKVVRNFLYAQKVQSPVELYSDWLSVGHVDEFLSFV
PAPGPKGFRLLLASPDACFKLFQEKKDEGYGTATQFEGLKRRKKKITIDEMLNDRSLRSD
NRYAQKCIDWNREVLKRELGLSESDIVDIPQLFKLSDSYAEAFFPDMVNMIVLGKFLGIP
KPFGPIINGRCCLEQKVQDLLQPLGLKCTFIDDYQSYHVLMGEIHCGTNVRRKPFSFKWW
NMIP
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcagagagccatccggctgtccctgcagaagcccacgcacgccgtgtgtgtg
gtgggcaccgaggtcgcgctggacgtctatggttcagtacctccacgagctgtgactttc
aaggtcactggaagctcatcagtgcagatctacatggaatacgaccctaagaatgtgagt
gaacctccggctgatgagcgctggcctttggatgctgacgtggacgtcgtcctatccgtg
gaagccgccagtaccaatgttgatgatgtcaaggtacgtgtctcttactatgggaagaat
gggagccaagcccttggccaggccctgctgcatctcactgccattgaagtgtctctggat
gttgacacgggccgtactgggacaataaagaggaacaaagatgacaagaaaacatggagc
tggggtccagaaggccgtggggcaatccttttggtgaactgcgacagggatagtcacctc
cctgggggggtcgactactctcatagtcgcttgtattccctggcagacctgcaggatatg
tccaagatggtgctctggaccaacggccccgataagatcttcgacaaccacaagcttgtc
ctgcacgtgtcacacaatgactcagacaaagtgagggtattccatgcccaaggtgggaac
cgtgtttctgactacaagagggtcctgggacctgacaaattgtcatacagcgtggatcgg
ggccctggtgaacaggagatcaccttctatgtggagggccttgccttccctgatgctgat
ttctttggactggtctccttcgacatcaccctgatggacacagatggactcctcgaaacc
ccgattttcacagacacggtggtgttccgagtggccccctggatcatgacccctaatacc
cagacacccctggatgtttacgtgtgcagtcttgtggaacgagaatcattccaagctgaa
tttcttgatgctatgacctacttgacattgaaggctaagtgtcaactgatcatctgtcca
ttggtggataaccgaaatgatcgctggatccaggatgaattggagtttggctacatagaa
gcacctcacaaagctttcccggttgtctttgattctcctcggaacagagggctgaaggaa
tttccctttaagaggatcctgggccctgactttggttatgtgacccgagagcctgcgcat
ggtggtgtctccagtcttgactcctttggaaacctggatgtcagcccacctgtcactgtc
caggggaaggagtacccactgggcagaatcctcattgggagcagcttccccaagtcaggt
ggccgccggatggctaaggtcgtccggaactttctgtatgcccagaaggtacagtccccc
gtggaactctattctgactggttaagcgtgggccacgtggatgagttcctcagcttcgtt
cctgcccctggaccgaagggtttccggctgttactggctagccccgatgcttgcttcaaa
ctctttcaggagaagaaggatgagggctatgggactgccacccagtttgaaggattgaaa
aggagaaagaaaaaaataaccattgatgagatgctgaatgatagaagccttagaagtgac
aatcgttatgcgcagaaatgcattgactggaaccgtgaggtcctgaaacgggagctgggc
ctgtcagagagtgacatcgttgacatcccccagctcttcaagctcagtgactcctacgca
gaggccttcttccctgacatggtaaacatgatcgtcttggggaagttcttggggattccc
aagccctttggacccatcattaatgggcgctgctgtctggaacagaaggtccaggacttg
ctgcagccgctgggactcaagtgcactttcattgatgattaccaatcctaccacgtgtta
atgggcgagatccactgtggcactaatgtccgacggaagcccttttcttttaagtggtgg
aacatgattccctga

DBGET integrated database retrieval system