KEGG   Sarcophilus harrisii (Tasmanian devil): 100923766Help
Entry
100923766         CDS       T02286                                 

Gene name
PADI1
Definition
(RefSeq) peptidyl arginine deiminase, type I
  KO
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     100923766 (PADI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 653 aa AA seqDB search
MGSFVWAQPLTTRLEQGSLSSVPPRAVTFKVTGSSSVQIYMEYDPKNVSEPPADERWPLD
ADVDVVLSVEAASTNVDDVKVRVSYYGKNGSQALGQALLHLTAIEVSLDVDTGRTGTIKR
NKDDKKTWSWGPEGRGAILLVNCDRDSHLPGGVDYSHSRLYSLADLQDMSKMVLWTNGPD
KIFDNHKLVLHVSHNDSDKVRVFHAQGGNRVSDYKRVLGPDKLSYSVDRGPGEQEITFYV
EGLAFPDADFFGLVSFDITLMDTDGLLETPIFTDTVVFRVAPWIMTPNTQTPLDVYVCSL
VERESFQAEFLDAMTYLTLKAKCQLIICPLVDNRNDRWIQDELEFGYIEAPHKAFPVVFD
SPRNRGLKEFPFKRILGPDFGYVTREPAHGGVSSLDSFGNLDVSPPVTVQGKEYPLGRIL
IGSSFPKSGGRRMAKVVRNFLYAQKVQSPVELYSDWLSVGHVDEFLSFVPAPGPKGFRLL
LASPDACFKLFQEKKDEGYGTATQFEGLKRRKKKITIDEMLNDRSLRSDNRYAQKCIDWN
REVLKRELGLSESDIVDIPQLFKLSDSYAEAFFPDMVNMIVLGKFLGIPKPFGPIINGRC
CLEQKVQDLLQPLGLKCTFIDDYQSYHVLMGEIHCGTNVRRKPFSFKWWNMIP
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgggttcttttgtgtgggctcagcctctgactactcggctggagcagggctctctcagt
tcagtacctccacgagctgtgactttcaaggtcactggaagctcatcagtgcagatctac
atggaatacgaccctaagaatgtgagtgaacctccggctgatgagcgctggcctttggat
gctgacgtggacgtcgtcctatccgtggaagccgccagtaccaatgttgatgatgtcaag
gtacgtgtctcttactatgggaagaatgggagccaagcccttggccaggccctgctgcat
ctcactgccattgaagtgtctctggatgttgacacgggccgtactgggacaataaagagg
aacaaagatgacaagaaaacatggagctggggtccagaaggccgtggggcaatccttttg
gtgaactgcgacagggatagtcacctccctgggggggtcgactactctcatagtcgcttg
tattccctggcagacctgcaggatatgtccaagatggtgctctggaccaacggccccgat
aagatcttcgacaaccacaagcttgtcctgcacgtgtcacacaatgactcagacaaagtg
agggtattccatgcccaaggtgggaaccgtgtttctgactacaagagggtcctgggacct
gacaaattgtcatacagcgtggatcggggccctggtgaacaggagatcaccttctatgtg
gagggccttgccttccctgatgctgatttctttggactggtctccttcgacatcaccctg
atggacacagatggactcctcgaaaccccgattttcacagacacggtggtgttccgagtg
gccccctggatcatgacccctaatacccagacacccctggatgtttacgtgtgcagtctt
gtggaacgagaatcattccaagctgaatttcttgatgctatgacctacttgacattgaag
gctaagtgtcaactgatcatctgtccattggtggataaccgaaatgatcgctggatccag
gatgaattggagtttggctacatagaagcacctcacaaagctttcccggttgtctttgat
tctcctcggaacagagggctgaaggaatttccctttaagaggatcctgggccctgacttt
ggttatgtgacccgagagcctgcgcatggtggtgtctccagtcttgactcctttggaaac
ctggatgtcagcccacctgtcactgtccaggggaaggagtacccactgggcagaatcctc
attgggagcagcttccccaagtcaggtggccgccggatggctaaggtcgtccggaacttt
ctgtatgcccagaaggtacagtcccccgtggaactctattctgactggttaagcgtgggc
cacgtggatgagttcctcagcttcgttcctgcccctggaccgaagggtttccggctgtta
ctggctagccccgatgcttgcttcaaactctttcaggagaagaaggatgagggctatggg
actgccacccagtttgaaggattgaaaaggagaaagaaaaaaataaccattgatgagatg
ctgaatgatagaagccttagaagtgacaatcgttatgcgcagaaatgcattgactggaac
cgtgaggtcctgaaacgggagctgggcctgtcagagagtgacatcgttgacatcccccag
ctcttcaagctcagtgactcctacgcagaggccttcttccctgacatggtaaacatgatc
gtcttggggaagttcttggggattcccaagccctttggacccatcattaatgggcgctgc
tgtctggaacagaaggtccaggacttgctgcagccgctgggactcaagtgcactttcatt
gatgattaccaatcctaccacgtgttaatgggcgagatccactgtggcactaatgtccga
cggaagcccttttcttttaagtggtggaacatgattccctga

DBGET integrated database retrieval system