KEGG   Sarcophilus harrisii (Tasmanian devil): 100923766Help
Entry
100923766         CDS       T02286                                 

Gene name
PADI1
Definition
peptidyl arginine deiminase, type I
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 720 aa AA seqDB search
MGSFVWAQPLTTRLEQGSLRCVLRVGLWAAYLFLRLHPLQDTCLSSRHLKVIDAELGGAL
ELPSSSINLENRYTIFQTETLVHLFYNSVPPRAVTFKVTGSSSVQIYMEYDPKNVSEPPA
DERWPLDADVDVVLSVEAASTNVDDVKVRVSYYGKNGSQALGQALLHLTAIEVSLDVDTG
RTGTIKRNKDDKKTWSWGPEGRGAILLVNCDRDSHLPGGVDYSHSRLYSLADLQDMSKMV
LWTNGPDKIFDNHKLVLHVSHNDSDKVRVFHAQGGNRVSDYKRVLGPDKLSYSVDRGPGE
QEITFYVEGLAFPDADFFGLVSFDITLMDTDGLLETPIFTDTVVFRVAPWIMTPNTQTPL
DVYVCSLVERESFQAEFLDAMTYLTLKAKCQLIICPLVDNRNDRWIQDELEFGYIEAPHK
AFPVVFDSPRNRGLKEFPFKRILGPDFGYVTREPAHGGVSSLDSFGNLDVSPPVTVQGKE
YPLGRILIGSSFPKSGGRRMAKVVRNFLYAQKVQSPVELYSDWLSVGHVDEFLSFVPAPG
PKGFRLLLASPDACFKLFQEKKDEGYGTATQFEGLKRRKKKITIDEMLNDRSLRSDNRYA
QKCIDWNREVLKRELGLSESDIVDIPQLFKLSDSYAEAFFPDMVNMIVLGKFLGIPKPFG
PIINGRCCLEQKVQDLLQPLGLKCTFIDDYQSYHVLMGEIHCGTNVRRKPFSFKWWNMIP
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgggttcttttgtgtgggctcagcctctgactactcggctggagcagggctctctcagg
tgtgtgctacgtgtgggactgtgggccgcctacctgttcctcaggctacaccctctgcag
gacacatgcctatcttcacggcatcttaaggtcatagatgcagagctgggtggggcccta
gagcttccatccagctccatcaatttggagaataggtataccatctttcaaaccgaaacc
ttggttcatctattttataattcagtacctccacgagctgtgactttcaaggtcactgga
agctcatcagtgcagatctacatggaatacgaccctaagaatgtgagtgaacctccggct
gatgagcgctggcctttggatgctgacgtggacgtcgtcctatccgtggaagccgccagt
accaatgttgatgatgtcaaggtacgtgtctcttactatgggaagaatgggagccaagcc
cttggccaggccctgctgcatctcactgccattgaagtgtctctggatgttgacacgggc
cgtactgggacaataaagaggaacaaagatgacaagaaaacatggagctggggtccagaa
ggccgtggggcaatccttttggtgaactgcgacagggatagtcacctccctgggggggtc
gactactctcatagtcgcttgtattccctggcagacctgcaggatatgtccaagatggtg
ctctggaccaacggccccgataagatcttcgacaaccacaagcttgtcctgcacgtgtca
cacaatgactcagacaaagtgagggtattccatgcccaaggtgggaaccgtgtttctgac
tacaagagggtcctgggacctgacaaattgtcatacagcgtggatcggggccctggtgaa
caggagatcaccttctatgtggagggccttgccttccctgatgctgatttctttggactg
gtctccttcgacatcaccctgatggacacagatggactcctcgaaaccccgattttcaca
gacacggtggtgttccgagtggccccctggatcatgacccctaatacccagacacccctg
gatgtttacgtgtgcagtcttgtggaacgagaatcattccaagctgaatttcttgatgct
atgacctacttgacattgaaggctaagtgtcaactgatcatctgtccattggtggataac
cgaaatgatcgctggatccaggatgaattggagtttggctacatagaagcacctcacaaa
gctttcccggttgtctttgattctcctcggaacagagggctgaaggaatttccctttaag
aggatcctgggccctgactttggttatgtgacccgagagcctgcgcatggtggtgtctcc
agtcttgactcctttggaaacctggatgtcagcccacctgtcactgtccaggggaaggag
tacccactgggcagaatcctcattgggagcagcttccccaagtcaggtggccgccggatg
gctaaggtcgtccggaactttctgtatgcccagaaggtacagtcccccgtggaactctat
tctgactggttaagcgtgggccacgtggatgagttcctcagcttcgttcctgcccctgga
ccgaagggtttccggctgttactggctagccccgatgcttgcttcaaactctttcaggag
aagaaggatgagggctatgggactgccacccagtttgaaggattgaaaaggagaaagaaa
aaaataaccattgatgagatgctgaatgatagaagccttagaagtgacaatcgttatgcg
cagaaatgcattgactggaaccgtgaggtcctgaaacgggagctgggcctgtcagagagt
gacatcgttgacatcccccagctcttcaagctcagtgactcctacgcagaggccttcttc
cctgacatggtaaacatgatcgtcttggggaagttcttggggattcccaagccctttgga
cccatcattaatgggcgctgctgtctggaacagaaggtccaggacttgctgcagccgctg
ggactcaagtgcactttcattgatgattaccaatcctaccacgtgttaatgggcgagatc
cactgtggcactaatgtccgacggaagcccttttcttttaagtggtggaacatgattccc
tga

DBGET integrated database retrieval system