KEGG   Sarcophilus harrisii (Tasmanian devil): 100923959Help
Entry
100923959         CDS       T02286                                 

Gene name
ACHE
Definition
(RefSeq) acetylcholinesterase
  KO
K01049  acetylcholinesterase [EC:3.1.1.7]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00564  Glycerophospholipid metabolism
shr04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100923959 (ACHE)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    100923959 (ACHE)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     100923959 (ACHE)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:shr00537]
 Enzymes
  100923959 (ACHE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase AChE_tetra Abhydrolase_3
Motif
Other DBs
NCBI-GeneID: 100923959
NCBI-ProteinID: XP_003768890
Ensembl: ENSSHAG00000007328
UniProt: G3VZ51
Position
4
AA seq 612 aa AA seqDB search
MRMAIRFSLLLLHSPSPSLLLLLFLLGRGVEAETTEDPELLVTVKEGKLRGIHLNAPGGP
VSAFLGIPFAEPPVESRRFLPPEPKRAWNGVLDATSYQRVCFQYVDNLYPGFQGSEMWNP
NRALSEDCLYLNVWTPSPRPVVPAPVLVWIYGGGFYSGASSLDVYDGRFLARVEGTVLVS
MNYRVGAFGFLALPGSREAPGNVGLLDQRLAMQWVQDNVAAFGGDPKSVTLFGESAGAAS
VGMHLLSPPSRGLFHRAVLQSGAPNGPWATVEADEARRRATHLARLVGCPTGTNDTELVV
CLRKRPAQDLVDKEWLVLPQQSVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVGVV
QDEGSYFLVYGAPGFSKDNESLINRAQFLAGVQVGVPQASELAAEAVVLHYTDWLHPDDP
ARLREALGDVVGDHNVVCPVAQLAGGLAAQGARVYAYVFDHRASTLSWPLWMGVPHGYEI
EFVFGLPLEPTLNYTGPERILARRLMRYWANFARTGDPNEPREREAPRWPTYTAGDQQYV
SLNLRPLEIQRGLRAQACAFWNRFLPKLLSATDSLDEAERQWKAEFHRWSSYMVHWKNQF
DHYSKQERCSDL
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgaggatggccattcgattctctcttctgcttctccatagtccttccccatcccttctc
ctcctcctcttcctcctaggccggggggtagaggctgaaaccactgaggatcctgagctg
ctggtgacagtaaaggaaggcaagcttcgtgggattcacctcaatgccccagggggccct
gtttctgccttcttgggcatcccttttgctgagcccccagtggaatctaggcgctttttg
cctccagaacccaaacgggcatggaatggggtcttggatgccacatcctaccagcgtgtc
tgcttccagtatgtggacaacctgtatccaggtttccaagggtctgagatgtggaaccct
aaccgggcactaagtgaggactgcctatatcttaatgtgtggacaccctccccccgtcca
gtggttcctgcaccagtcctggtctggatctatgggggtggcttttacagtggggcctcc
tcccttgatgtttatgatggacgattcctggctagggttgagggcactgtacttgtttct
atgaactaccgagtaggtgcctttggcttcctggcactaccagggagtcgggaggcacca
ggcaatgtggggctgctggatcagcgactggcaatgcagtgggtgcaggacaatgtggca
gccttcggaggggacccaaaatcagtgacactatttggggaaagtgctggagctgcttct
gtaggcatgcatcttctatcacctccaagccgtgggctattccatagggcagtgttgcaa
agtggggctcccaatggaccttgggccacagtggaagcagatgaggctcgtagacgagct
actcatctggccaggttagtgggttgtcctactggcactaatgacactgagctggtggtc
tgcctgaggaaacgtccagcccaggatcttgtagacaaggaatggctggtgctgcctcaa
cagagtgtcttccgattctcctttgttcctgttgtggatggagacttcctcagtgatact
cctgaggccctcatcaatgctggagattttcatggccttcaggtgctggtaggtgtagta
caggatgagggctcctatttcctggtctatggggcccctggcttcagcaaggataatgag
tctctgatcaatagggcccagttcctggctggagtgcaggttggggtccctcaagcgagt
gagttggcagcagaggctgttgttctgcactacacggactggctacaccctgatgaccct
gcacgacttcgtgaggctttgggtgatgttgtgggtgaccacaatgtggtatgtcctgtg
gcccagctagcaggaggacttgctgcacaaggtgcccgtgtttatgcctatgtctttgac
catcgagcctctacgttgtcttggcccctctggatgggtgtcccccatggctatgagatt
gaatttgtctttggccttccccttgaaccaacactcaactacactggccctgaaagaatc
cttgctcggagactgatgagatactgggccaactttgcccgtacaggtgatccaaacgag
ccccgggaacgtgaagcccctcgctggcctacctacacagctggggatcagcagtacgta
agcctcaacctgcggccactggaaatacagcgagggctccgggcacaggcctgcgccttc
tggaaccgattcctgccaaagttgctcagcgctaccgatagcctggatgaggcggaacgc
cagtggaaggcggagttccaccgctggagctcctacatggtgcactggaagaaccagttc
gaccattacagcaaacaggagcgttgctctgacctatga

DBGET integrated database retrieval system