KEGG   Sarcophilus harrisii (Tasmanian devil): 100923959Help
Entry
100923959         CDS       T02286                                 

Gene name
ACHE
Definition
(RefSeq) acetylcholinesterase (Yt blood group)
  KO
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Glycerophospholipid metabolism
Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100923959 (ACHE)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    100923959 (ACHE)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     100923959 (ACHE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 610 aa AA seqDB search
MAIRFSLLLLHSPSPSLLLLLFLLGRGVEAETTEDPELLVTVKEGKLRGIHLNAPGGPVS
AFLGIPFAEPPVESRRFLPPEPKRAWNGVLDATSYQRVCFQYVDNLYPGFQGSEMWNPNR
ALSEDCLYLNVWTPSPRPVVPAPVLVWIYGGGFYSGASSLDVYDGRFLARVEGTVLVSMN
YRVGAFGFLALPGSREAPGNVGLLDQRLAMQWVQDNVAAFGGDPKSVTLFGESAGAASVG
MHLLSPPSRGLFHRAVLQSGAPNGPWATVEADEARRRATHLARLVGCPTGTNDTELVVCL
RKRPAQDLVDKEWLVLPQQSVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVGVVQD
EGSYFLVYGAPGFSKDNESLINRAQFLAGVQVGVPQASELAAEAVVLHYTDWLHPDDPAR
LREALGDVVGDHNVVCPVAQLAGGLAAQGARVYAYVFDHRASTLSWPLWMGVPHGYEIEF
VFGLPLEPTLNYTGPERILARRLMRYWANFARTGDPNEPREREAPRWPTYTAGDQQYVSL
NLRPLEIQRGLRAQACAFWNRFLPKLLSATDSLDEAERQWKAEFHRWSSYMVHWKNQFDH
YSKQERCSDL
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggccattcgattctctcttctgcttctccatagtccttccccatcccttctcctcctc
ctcttcctcctaggccggggggtagaggctgaaaccactgaggatcctgagctgctggtg
acagtaaaggaaggcaagcttcgtgggattcacctcaatgccccagggggccctgtttct
gccttcttgggcatcccttttgctgagcccccagtggaatctaggcgctttttgcctcca
gaacccaaacgggcatggaatggggtcttggatgccacatcctaccagcgtgtctgcttc
cagtatgtggacaacctgtatccaggtttccaagggtctgagatgtggaaccctaaccgg
gcactaagtgaggactgcctatatcttaatgtgtggacaccctccccccgtccagtggtt
cctgcaccagtcctggtctggatctatgggggtggcttttacagtggggcctcctccctt
gatgtttatgatggacgattcctggctagggttgagggcactgtacttgtttctatgaac
taccgagtaggtgcctttggcttcctggcactaccagggagtcgggaggcaccaggcaat
gtggggctgctggatcagcgactggcaatgcagtgggtgcaggacaatgtggcagccttc
ggaggggacccaaaatcagtgacactatttggggaaagtgctggagctgcttctgtaggc
atgcatcttctatcacctccaagccgtgggctattccatagggcagtgttgcaaagtggg
gctcccaatggaccttgggccacagtggaagcagatgaggctcgtagacgagctactcat
ctggccaggttagtgggttgtcctactggcactaatgacactgagctggtggtctgcctg
aggaaacgtccagcccaggatcttgtagacaaggaatggctggtgctgcctcaacagagt
gtcttccgattctcctttgttcctgttgtggatggagacttcctcagtgatactcctgag
gccctcatcaatgctggagattttcatggccttcaggtgctggtaggtgtagtacaggat
gagggctcctatttcctggtctatggggcccctggcttcagcaaggataatgagtctctg
atcaatagggcccagttcctggctggagtgcaggttggggtccctcaagcgagtgagttg
gcagcagaggctgttgttctgcactacacggactggctacaccctgatgaccctgcacga
cttcgtgaggctttgggtgatgttgtgggtgaccacaatgtggtatgtcctgtggcccag
ctagcaggaggacttgctgcacaaggtgcccgtgtttatgcctatgtctttgaccatcga
gcctctacgttgtcttggcccctctggatgggtgtcccccatggctatgagattgaattt
gtctttggccttccccttgaaccaacactcaactacactggccctgaaagaatccttgct
cggagactgatgagatactgggccaactttgcccgtacaggtgatccaaacgagccccgg
gaacgtgaagcccctcgctggcctacctacacagctggggatcagcagtacgtaagcctc
aacctgcggccactggaaatacagcgagggctccgggcacaggcctgcgccttctggaac
cgattcctgccaaagttgctcagcgctaccgatagcctggatgaggcggaacgccagtgg
aaggcggagttccaccgctggagctcctacatggtgcactggaagaaccagttcgaccat
tacagcaaacaggagcgttgctctgacctatga

DBGET integrated database retrieval system