KEGG   Sarcophilus harrisii (Tasmanian devil): 100924032Help
Entry
100924032         CDS       T02286                                 

Gene name
PADI2
Definition
(RefSeq) protein-arginine deiminase type-2
  KO
K01481  protein-arginine deiminase [EC:3.5.3.15]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     100924032 (PADI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAD PAD_M PAD_N
Motif
Other DBs
NCBI-GeneID: 100924032
NCBI-ProteinID: XP_012401069
Ensembl: ENSSHAG00000006610
Position
3
AA seq 665 aa AA seqDB search
MPQERTVRLQYGNRIEAVCVLGTRLWVDVYSAAPADAKTFSLKHTAAVQVEAVIDGQAEE
ATANGKQRWALSPSTILRLSMNQPSTDVSSDKVTVNYYAEESNTPIDQAGLFLTAIEISL
DVDADRDGIVEKNNPKKASWTWGPDGHGAILLVNCDREIPWLPKEDCSDNKIYTKEDLKD
MSPMILRTNGPTQLPKGYEMVLYISISDSDKVGVFYVDNPFFGQRYIHILGRQKLFHVVK
YTGGKAELEFFVEGLRFPDESFSGLVSIHVTLLELLMEGLPQTPIFTDTVIFRVAPWIMT
PNTLPPVSVLVCSMKDNYLFLKEIKNLIEKTNCKLKICFQYMNRGDRWIQDEVEFGYIDA
PHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFEEVTSLDSFGNLEVSPPVTVN
GKEYPLGRILIGSSFPLSGGRRMTKVVRDFLQAQLVQAPVELYSDWLIVGHVDEFMTFVP
IPNKKEFRLLMASTSACYKLFREKQKQGHGEAILFKGLGGMSNKRITINKILSNENLVQQ
NLYAQRCLDWNRDILKKELGLTEKDIIDLPALFKLNEDGQAMAYFPNMVNMIVLDKDLGV
PKPFGPLIEEQCCLEAHVCSLLQPLGFSCTFIDDISSYHKLMGEVHCGTNVCRKPFAFKW
WNVVP
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaggagcggaccgtgcgtctacaatacgggaaccgcatcgaggcggtgtgtgtg
ctgggcactcggctctgggtagatgtctacagtgcagcccctgctgatgccaaaaccttc
agcctgaaacacacagctgccgtacaagtagaggcagtgatcgatgggcaggctgaggag
gccacggccaatggcaaacagcgatgggccctctcccccagcaccattctccgtctcagc
atgaaccagcccagcacagatgtcagcagcgataaggtgaccgtcaactattatgcagag
gaaagcaatactcccattgatcaagctggtcttttcctcacggctattgagatctccctg
gatgtggatgcagatcgagatggaattgtggaaaagaataatcctaagaaggcatcctgg
acctggggccctgatggccacggggccatcctgctggtgaactgtgacagggaaatcccc
tggctgcccaaggaagattgctctgacaacaagatctacaccaaagaagacctgaaggac
atgtctccgatgatcctgaggaccaatggccccacccaactcccaaaaggctatgaaatg
gttctctacatttccatcagtgactcggacaaagtgggcgtgttctatgtggataaccca
ttcttcggtcagcgttacatccacattctcggccggcagaagctcttccacgtggtaaag
tacacaggtggcaaagccgagctagaattctttgtggaaggccttcgattccctgatgag
agtttctcgggcctggtctccatccatgtcaccctgctggagcttctgatggagggactt
ccccaaactccaatcttcacagacacagtgattttccgtgtggctccatggatcatgacc
ccaaatactttgcctcctgtatcagttttagtgtgcagcatgaaggacaattacctgttc
ctcaaggagataaagaacctgatagagaaaaccaactgcaagcttaagatctgttttcag
tatatgaaccgtggggatcgttggattcaggatgaagttgagtttggctacattgatgct
ccccacaagggcttccctgtggtcctagattccccgcgagatgggaacctgaaagacttc
ccagtgaaagagctcctgggcccagactttggctacgtcacccgggagccgctcttcgag
gaagtcaccagcctggattcctttgggaacctggaggtcagcccgcctgtgacggtgaac
ggcaaggagtaccccctgggcaggatcctcatcggcagcagcttccctctgtctggtggg
agacggatgacaaaggtcgtgagagatttcctgcaagcacagttagtacaggcacctgtg
gagctgtattctgactggctgatcgttggccacgtggatgaatttatgaccttcgtgccc
atccctaacaaaaaggaattccggctgctcatggccagtacctctgcctgctacaagctc
ttccgggaaaagcaaaaacaagggcatggagaagccatcttgttcaaaggcttggggggc
atgagcaacaaacgcattaccatcaataagatcctgtccaatgagaatctggtgcagcag
aacctgtatgcccagcgttgcctggattggaaccgcgacatcctgaaaaaggaactggga
ttgacagagaaagatatcattgatctcccagctctgttcaagttaaatgaggatggccaa
gccatggcttatttccccaacatggtgaatatgatcgtgcttgacaaggacctgggtgtt
cccaagccctttgggcccctgatcgaggagcagtgctgcctagaagctcatgtgtgctca
cttctgcaacccctgggtttctcctgtaccttcatcgatgacatttcctcctatcacaaa
ttaatgggcgaggtccactgtggtaccaacgtctgccggaaaccctttgccttcaagtgg
tggaatgtggtgccttaa

DBGET integrated database retrieval system