KEGG   Sarcophilus harrisii (Tasmanian devil): 100924053Help
Entry
100924053         CDS       T02286                                 

Gene name
EEA1
Definition
(RefSeq) early endosome antigen 1
  KO
K12478  
early endosome antigen 1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Endocytosis
Phagosome
Tuberculosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100924053 (EEA1)
   04145 Phagosome
    100924053 (EEA1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    100924053 (EEA1)
Membrane trafficking [BR:shr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100924053 (EEA1)
 Protein recycling
   Others
    100924053 (EEA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
5
AA seq 1334 aa AA seqDB search
TPGRVGSQGSDSDSSATPGNVLDVNNEGSSEGFICPQCMKSHGSAEELFKHYQAVHDSGS
ESSHGGESLKREDVILLRQEVQDLQASLKEEKWYSEELKKELEKLQGQRQQEFKPDGLTA
DSSAELQSLEQQLDEAQTENFNIKQMKDLFEQKAAQLATEVADIKSKYDEEKGLREAAEQ
KVTSLTEELKKETTVIQDLKTELLQRPGVEDVAVLKKELVQVQTLMDNMTLEREKESEKL
KEECRKLQADCANSEITINQLRSELAKGPQEVAVYVQELQKLQSSVNELTQKNQNLSEKL
LKKEQDYTQLEEKQNEEYVCKKNIQANLHQKELDCQQLQSKLSSSEASLQRLQGELVEKG
EVSQKLKEELSEVESKYQHLKVEFKQLQQQREEKEQHGFQLQSEINQLHSKLLETERQLG
EAHGRLKEQRQLSSEKLMDKEQQVADLQLKLSRLEEQLKEKVTNFTELQHQLDKARQQHQ
EQQALQQSTTSKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENITLLEKEREDLYA
KIQAGEGETAVLNQLQEKNHTLQEQVTQLNEKLKNQSESHKQAQENLHEQVQEQKAHLRA
AQDRVLALEANINEVTSQLNESREKVSQLDLQIKAKTELLLSAEAAKTAQRADLQNHLDT
AQNALQDKQQELNKISNQLDEVTVQLHDKQDHCTQLEASIKELKEKQLSNEQRAEELEGQ
VKKLEVDILEAKASKEQVLHDLQEQRQQNAELNLRAAELSQQLETEREVVSNAHSDLRKK
IDALEHATQMLSKHEKEKADLKQELQKLHQDAENQRKELDGKMNAAVTDLQQVKVERERL
AKELSTTKDKLSKISESLKVSKNELEKEKQNGKTALVELEKICKELKHQVQTECAMKEKN
EPKTLAEKEKEQLKLPPSAAKEQVLHVQNDSKEKEKEEQQLHGKLNSLKQLHELRKKQIE
ELHEEIKTTLFQKSVEEKLSLAQEDLISNRNQLGNQNKMIQELKSAKASLEQDVSKKEQQ
LQEQGKTLQSMQKDKSLKEKELANEKSKLMELQEIKGRQEKEITKLSEELGSYKQESLKE
ITNLKDAKQLLIQQKLELKGKLDALGSALEQEKKNQQIVKDQLKKTEDDLKKEFIEKEAK
LNAEIKEKEEKIRKHEENETRLAMQVTALNENLGTVKKEWQASQRRVSELEKQIDDLRGE
IAVLEATIQNNQDERRALLERCLKSEGEIEKLQAKVLELQRKLDNTTAAVQELGRENQSL
QIKHTQALSRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKK
PVRVCNDCFNDLQG
NT seq 4005 nt NT seq  +upstreamnt  +downstreamnt
accccagggagagttggctctcaaggttctgattctgattcatcagcaacacctggaaat
gtcttggatgtcaacaatgaaggctcttcagagggcttcatatgcccccagtgtatgaaa
tctcatggatctgctgaagagcttttcaagcattatcaggcagttcatgactctggtagt
gaatcaagtcatggaggagagtctctaaaacgagaagatgtgatactactccgacaagag
gtccaagacctacaggcttcactgaaggaagaaaaatggtactcagaagagttgaagaaa
gaattagaaaaattacaagggcagcggcagcaagaattcaaacctgatggattgacagca
gattcatcagcagaactccagtcattggaacaacaattagatgaagctcaaactgaaaac
tttaatattaaacaaatgaaagacttatttgagcagaaagcagcgcagcttgctacagaa
gttgcagatataaagtcaaagtatgatgaagaaaagggacttcgagaagctgctgaacag
aaggtgacaagcttgactgaagagttaaagaaagagacaactgtaattcaagatttaaag
actgaattgcttcaaagacctggcgtagaagatgttgctgtattgaagaaagagctagtc
caagttcagaccttaatggacaacatgactttggagcgtgagaaagagtcagagaaactc
aaagaggaatgtagaaagctacaggctgattgtgctaactcagagatcacaataaaccag
ttaagaagtgaacttgctaaaggcccccaggaagttgccgtgtatgtacaggagctgcag
aaacttcaaagttcagttaatgaattaactcagaaaaatcagaatttgtctgaaaagtta
ctgaagaaagaacaagattacactcagttagaggagaaacaaaatgaagagtatgtttgt
aaaaagaatattcaagcaaaccttcatcaaaaagaactggattgtcagcagcttcaatca
aaattatcatcatctgaagcctcactgcaaaggttacagggagagcttgtggaaaagggg
gaagtgagccagaagctcaaggaggaattgtcagaagtagagagcaagtatcagcatctc
aaggtggaattcaaacaactccagcaacaaagagaggagaaagagcagcatggttttcaa
cttcaaagtgagattaatcaattacacagcaaacttttggagacagaacgacaattaggt
gaggctcatggcaggcttaaagaacagagacagctctccagtgaaaaattgatggacaaa
gaacaacaagtggctgatctacaattaaaactttctcgcttagaagaacagttgaaggaa
aaagtaacaaatttcactgaactgcagcatcagttagataaagcaaggcagcaacatcaa
gagcagcaggccttgcagcagagcaccacatccaagcttcgggaagcccagaatgatttg
gaacaagtattacgtcaaattggagataaggaccaaaagattcaaaatcttgaagccttg
ctacagaagagtaaggagaacatcacattacttgaaaaagagagagaagatctttatgca
aaaattcaagctggtgaaggagagactgctgttcttaaccaattacaagagaaaaaccat
acattacaagaacaggtaactcaactcaacgagaagctgaaaaaccagtcggaaagtcac
aaacaggcccaggagaatttgcacgagcaggtgcaggagcagaaggcacacctgcgagcc
gcacaagaccgagttcttgccctagaagccaatattaatgaagtgacaagtcagttaaat
gagagtagggagaaggtctcccaacttgatttacagattaaagcaaaaactgaattattg
ctctctgctgaagcagcaaaaactgctcaaagagcagatcttcagaatcacttggacaca
gcgcagaatgcattgcaagacaagcaacaggagttaaataaaatcagtaatcagttggat
gaagtaactgtgcagctgcatgacaagcaagaccactgtacccaactggaagcctccatt
aaggaattaaaagaaaaacagctctctaatgagcaaagagctgaagaattagagggacaa
gtgaagaaactggaggttgatattcttgaagctaaagcaagtaaggaacaagttttacat
gatctacaagaacaaaggcagcagaatgcagaattaaatctccgagctgcagagctgagt
caacaactggaaactgagagagaagttgtctctaatgcccattcggatctacggaaaaaa
attgatgctctcgaacatgcaacacaaatgctttccaaacatgagaaagaaaaagcagac
cttaagcaagaacttcagaaattacatcaagatgcagagaatcagcgtaaggaattggat
ggcaagatgaatgcagcagtgacagatttacagcaagtgaaggtggagcgagaacgtcta
gcaaaggagctttctacaactaaagacaaattgtcaaaaatctctgagtctttgaaagtc
tcaaagaatgaattagaaaaggaaaagcaaaatggaaaaacagctttggtagaattggaa
aagatttgcaaggaactaaagcatcaagtacagactgaatgtgctatgaaggaaaagaat
gaaccaaaaacgttagctgaaaaggagaaggagcagttgaagttgccacccagtgctgca
aaggaacaggtcttacatgttcaaaatgattcaaaggaaaaggaaaaagaggagcaacaa
cttcatggaaaactaaattcactaaagcaattacatgagctgaggaagaagcagattgaa
gagctccacgaagaaataaaaactacacttttccagaagtctgtagaagaaaagctctcc
ctggctcaggaggacttgatttcaaaccgaaaccaacttggaaatcagaataaaatgatt
caagaacttaagagtgccaaggcctctttggagcaagatgtttcaaaaaaagagcaacag
ttacaagaacagggcaagacacttcagtctatgcaaaaagacaagtcactgaaagaaaaa
gaactagctaatgagaaatccaaattgatggaactacaagaaattaagggtaggcaggaa
aaagaaattaccaaattgagtgaagaacttggttcttacaaacaagaaagcctgaaggaa
ataacaaatctaaaggatgccaaacagctgttgatacagcagaaactagaacttaagggc
aaattagatgccctgggttcagctcttgaacaggaaaagaagaaccaacaaatagtaaaa
gatcagttgaaaaagactgaagatgatctgaagaaagaattcattgagaaggaggccaaa
ttgaatgcagaaataaaagaaaaggaagagaaaattaggaaacatgaagagaatgagact
agacttgccatgcaagtgacagctttgaatgagaatttgggcacagtcaagaaagaatgg
caggccagccaacggagagttagtgagctagagaaacagattgatgacttacggggtgaa
attgcagtactggaagcaactattcaaaataatcaagatgaaaggagagcattgttggaa
agatgtcttaaaagtgaaggtgaaatagagaaacttcaagccaaagtactagagttgcag
agaaaactggataatactactgcagcagtacaggaattaggcagagaaaatcagtcatta
cagatcaaacatacacaagctttaagtagaaaatgggctgaggataacgaggtacagaac
tgtatggcctgtgggaaaggtttttctgtcacagtgagacggcatcattgtagacaatgt
ggaaatatcttctgtgctgaatgttcggccaaaaatgccttaactccttcttcaaagaag
cctgttcgtgtctgtaatgattgtttcaatgatctacaaggataa

DBGET integrated database retrieval system