KEGG   Sarcophilus harrisii (Tasmanian devil): 100924119Help
Entry
100924119         CDS       T02286                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: aldehyde oxidase 4-like
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00280  Valine, leucine and isoleucine degradation
shr00350  Tyrosine metabolism
shr00380  Tryptophan metabolism
shr00750  Vitamin B6 metabolism
shr00760  Nicotinate and nicotinamide metabolism
shr00830  Retinol metabolism
shr00982  Drug metabolism - cytochrome P450
shr01100  Metabolic pathways
shr04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100924119
   00350 Tyrosine metabolism
    100924119
   00380 Tryptophan metabolism
    100924119
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100924119
   00760 Nicotinate and nicotinamide metabolism
    100924119
   00830 Retinol metabolism
    100924119
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100924119
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    100924119
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     100924119
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2 DUF218 DHODB_Fe-S_bind
Motif
Other DBs
NCBI-GeneID: 100924119
NCBI-ProteinID: XP_012400368
Ensembl: ENSSHAG00000016877
Position
3
AA seq 1346 aa AA seqDB search
MTSTNPPQSDHLIFFVNGKKVVEKHADPEVTLLFYLRKVLCLTGTKYGCGTGGCGACTVM
ISKYNPITKKIRHYSATACLVPICSLHGAAVTTVEGIGSIKTRIHPVQERLAKCHGTQCG
FCSPGMVMSIYTLLRNHPDPSTEQLMEALGGNLCRCTGYRPIVESGKTFCEESTICQLQG
TGKCCMEKEENQFFLDKEEKVXHEFPFHVMCTKLYDESEFRPFDPSQEPIFPPELIRMAE
DPQKKTLIFYGDRVIWMTPANLNELLELRMKYPTAPLVAGNTTVGPNMKFKGEFHPIIIS
PVALQELNFVDFTDDGVTIGAGCSLAEMKESLTYTVSKEPEEKTKIYRALLKHLRTLAGQ
QIRNMATLGGHVASKHDYSDINPILAAGKAILNLISKKGERQMLIEELFTSTSLKEELHE
GEVIYSVVIPQLPKWNVIAAHRQAQRLENALAIVNAAMSVQFEEGTNSIKDFKMFFGNVG
SSTVSASKTCEQLIGKQWNDIMLSEACRLVLDEIQIPPTAVGGMVEYKRTLMISFIFKFY
LKVLRELHKLNPRMYPEIPETFMSALEEFPLNIPKGIQMFQCVDPHQSPQDPVGHPVMHQ
SGIKHATGEAVYNDDIPQVDKELHLAVVTSTRAHAKILSIDFSEALELPGVVDVITANDV
PGENNHEGEIFYAENEVICVGQIVCTVAADTYAHAKQAADKVKISYEDMEPRIITIEEAI
KHNSFLYKEKKIERGNVEKAFKYVDEIIEGEVHVEGQEHFYMETQTILVFPTEDKEMMIY
TGTQHPTQVQNFVAAALGVPRNRIMCHMKRTGGAFGGKMTKPSLLGAIAAVAAHKTGHPI
RFLLERGNDMLITAGRHPLLAKYKIGFMKNGLIKAVDLQYYVNAGCTPDESELVIEFIVL
KSETAYDIPNFRCRGRACKTNLPSNTAFRGFGFPQGILAVENYITAVAFKCGLPTEKVRE
MNMYKTVNKTAYKEPFNPKPLLKCWKECLEKSSFQSRKIAIEEFNRKNYWKKKGISVIPM
KFTVGVPTAYQSQAASLVHIYQDGSVLVTHGGCELGQGLYTKMIQVASRELKIPSSYIHV
SETSTTTVPNATYTAGSMGTDINGKAVQNACQILLKRLEPIIKKNPKGKWEEWTSQAFKE
SINLLAAGYFRGYQTNMDWEKEKGHPYPYFVYGATCSEVEIDCLTGAHKLLRTDMFMDAA
VSLNPAIDIGQVEGGLVQGMGLYTTEELKYSPEGVLYSRSPEDYKIPIVSEIPEEFYVTF
VHSRNPIAIYSTKGLGEAGMFMGSSVFFAITDAVAAARRERGLTELFTLNSPATPEMIRM
SCEDQFTKQIPRDDPSTFKPWSIHVS
NT seq 4041 nt NT seq  +upstreamnt  +downstreamnt
atgacctctactaatcctcctcagtctgatcacctgattttcttcgtgaatggaaaaaag
gtagtagaaaaacatgcagatcctgaagtgactctgttgttttacctgagaaaagtcctc
tgcctgacaggaaccaaatatggctgtggaacagggggctgtggagcctgcacagtgatg
atatcaaaatataatcccatcaccaagaagatccgtcattattctgccactgcttgcttg
gttcccatatgctctctccatggtgctgcagtcaccacagtggaaggcattggaagcatc
aaaaccaggattcatccagttcaggaaaggcttgccaaatgccatggcactcagtgtgga
ttctgcagcccaggaatggtgatgtccatatatactctactgaggaaccacccagatcca
tcgacagagcaattaatggaagctcttggtggtaatctgtgccgatgtactggataccga
ccaattgtagaaagtgggaagactttctgtgaggaatcaacaatttgtcagctccaagga
acaggaaagtgttgcatggaaaaagaagaaaatcaattcttcctggataaagaggaaaag
gtatgacatgaatttccctttcatgtgatgtgtacaaagctgtatgatgaaagtgaattc
cggcccttcgatccatcccaggaacctatatttccacctgagctaataaggatggcagaa
gatccccaaaagaaaactcttattttctatggagaccgggttatatggatgacacctgct
aacttgaatgaacttctggagctaagaatgaaataccctacagcaccccttgttgcgggt
aacaccacagtgggaccaaatatgaaattcaaaggagaattccaccccattattatctct
ccagttgcacttcaagaattaaattttgtggattttacagatgatggtgtgacaataggt
gctgggtgtagcctggctgaaatgaaagaaagtttgacttacacagtttcaaaggaacca
gaagaaaagactaaaatatatcgtgctctcctaaagcacttgcgaacattggcaggacag
cagatccggaacatggctactttagggggacatgtggcaagcaaacatgactattctgat
atcaaccccatcctggcagcaggaaaggccatcctcaatttaatctccaaaaaaggggaa
cggcaaatgcttatagaagaacttttcacatcaacatctctcaaagaagaacttcatgaa
ggagaggttatctattctgttgttattccccaactcccgaagtggaatgttatagcagcc
caccgacaagcacagcgtttagagaatgccttagcaattgttaatgctgcaatgagcgtc
cagtttgaagaaggaacaaacagtattaaggactttaagatgttctttggaaatgttggt
tcttccacagtctcagcaagtaaaacttgtgagcagctcattggcaaacaatggaacgac
attatgttgagtgaagcctgcagattggtgctggatgaaattcaaattccaccaacagca
gtgggaggcatggttgaatacaaaagaaccctgatgataagtttcatcttcaaattctac
cttaaagtactaagagaactacataagctgaatcccaggatgtacccagaaattccagaa
acttttatgagtgctctggaagaatttccccttaatattccaaaaggaatacaaatgttc
cagtgtgtagatcctcaccaatctccccaagatccagttggacatccagtcatgcaccag
tcagggattaaacatgccactggggaagctgtctataatgatgacatcccccaagttgac
aaagaactccacctggctgtagtgaccagtaccagagcacatgcaaaaatcttgtcaatt
gatttttcagaagccctagaattaccaggagtcgttgatgtgataactgctaatgatgtc
ccaggagaaaataaccatgaaggagaaatattttatgcagaaaatgaggtgatttgtgtg
ggtcagattgtctgtactgtggctgcagatacatatgcccatgcaaagcaagcagctgac
aaagtgaagattagttatgaagatatggagccaagaatcataaccatagaggaagccata
aagcataattcctttttatataaagagaagaaaatagaaaggggaaatgtagagaaagca
ttcaaatatgtagatgaaataattgaaggtgaagtccatgttgaagggcaagaacatttt
tatatggaaacacaaactatactggttttcccaacagaagataaagaaatgatgatatat
acaggaacacagcacccaacccaagttcagaactttgtagctgcagctttgggtgtccca
aggaacaggattatgtgccacatgaaacgaactggtggagcctttggagggaaaatgacc
aagccttctctgctgggagctattgctgcagtggctgctcacaagactggccacccaatt
cgttttcttctagaacgaggaaatgacatgctaataactgctggccgccaccctttgctt
gcaaaatataaaataggattcatgaaaaatggcctgatcaaagctgttgatcttcaatat
tatgtcaatgctgggtgtactccagatgagtctgagttggtgatagagttcattgtactg
aaatctgaaactgcttatgatattcccaattttcggtgcagaggtagggcttgcaaaaca
aatttgccatccaacacggcctttaggggatttggtttcccccaaggaattttggcagtt
gagaattacataacagctgtggcattcaaatgtggcttaccaacagagaaggtcagagaa
atgaacatgtacaaaacagttaataaaacagcttacaaggaaccatttaatccaaagcca
ttgttaaaatgttggaaagaatgcctagagaaatcttcattccagagcaggaaaatagcc
atagaagagtttaacaggaaaaattactggaagaagaaaggaatttctgttattcccatg
aaatttacagttggagtgcctactgcatatcaaagtcaggctgcttctcttgttcatatc
tatcaagatgggtctgtgttagtgactcatggtggctgtgaattggggcaaggtctttac
accaaaatgattcaggttgctagtcgagaactgaaaataccttcatcatacatacatgtt
tctgaaacaagcaccaccaccgtgcccaatgccacttatacagctggatctatggggaca
gacatcaatggaaaagcagttcagaatgcctgtcagattcttttgaagcgccttgaaccc
atcatcaaaaaaaatccaaaaggaaaatgggaagaatggacttctcaggcttttaaggaa
tccatcaatcttttagctgctggatatttcaggggctatcagacaaatatggattgggag
aaagaaaaaggtcatccatatccatattttgtttatggagcaacctgttctgaagttgag
attgattgtctgactggagctcataagctcctcagaactgacatgttcatggatgctgct
gtcagcctaaatcctgctattgacataggacaggttgaaggtggattagttcaaggcatg
ggattatatacaactgaagaactgaaatattccccagaaggtgttctttattctagaagt
ccagaagattataaaatccctatagttagtgaaattccagaagagttctatgtcactttt
gtgcattcccgaaacccaatagccatctactcaaccaagggcttaggggaggctggaatg
ttcatgggatcatctgtgttctttgctattactgatgctgttgctgcagctcgcagagaa
agaggactgacagaactcttcactttgaatagtccagcaactcctgagatgattaggatg
tcttgtgaggatcagtttactaaacagattcctagagatgatccttcaactttcaaacct
tggtccatccacgtttcctaa

DBGET integrated database retrieval system