KEGG   Sarcophilus harrisii (Tasmanian devil): 100924143Help
Entry
100924143         CDS       T02286                                 

Gene name
PDK2
Definition
pyruvate dehydrogenase kinase, isozyme 2
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 470 aa AA seqDB search
MIGGGRGRGTGDRLRERRPLKLCWRGRGGRSRLGGWLGRRERELSEAGPRSGAVAAADTT
AAAMRWVRALLKNASLAGAPKYIEHFSKFSPSPLSMKQFLDFGSSNACEKTSFTFLRQEL
PVRLANIMKEINLLPDRVLGTPSVQLVQSWYVQSLLDIMEFLDKDPEDHRTLGQFTDALI
TIRNRHNDVVPTMAQGVLEYKEAYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLIFD
GSTNPAHPKHIGSIDPNCDVSEVVKDAYDMAKLLCDKYYMASPSLEIQEINASNSKQPIH
MVYVPSHLYHMLFELFKNAMRATVESHESSLTLPPIKVMVALGEEDLSIKMSDRGGGVPL
RKIERLFSYMYSTAPTPQPGSGGTPLAGFGYGLPISRLYAKYFQGDLQLFSMEGFGTDAV
IYLKALSTDSVERLPVYNKSAWRHYQTIQEAGDWCVPSTEPKNTSTYRVS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgattggaggcggccgggggcgggggacgggtgataggctgagggagcgtaggccgcta
aagctgtgctggagggggaggggaggaaggagcaggctaggtggctggctcgggcgtcgg
gagcgggagctgagcgaagctgggccccggagtggggccgtcgccgctgctgacaccacc
gccgccgccatgcgctgggttcgggcgctgctaaaaaacgcgtccctggccggggcgccc
aaatacatcgagcacttcagcaagttttccccgtccccgctgtccatgaagcagtttctg
gactttggttccagcaatgcctgtgaaaaaacttccttcaccttcctgagacaggagctg
cctgtgcggctggccaatataatgaaggagatcaatttgcttccagaccgggtactagga
actccctcagtacagttggtacagagttggtatgtccaaagtcttctggacatcatggag
ttcctggacaaagatcctgaggaccatcgcactctgggacagttcacagatgccttgatc
acaatccgcaaccggcacaatgatgtggtccccactatggcccagggggtgctggaatac
aaagaggcctatggggatgatcccgtctccaaccagaacatccagtatttcctggaccgg
ttctatcttagccggatctccattcgaatgctcatcaaccagcatacattgatctttgat
ggcagcacgaaccctgcgcaccccaaacatattggcagtatcgatcccaactgcgatgtc
tctgaggtggtgaaagatgcctatgatatggccaaactcctgtgtgacaaatattacatg
gcctctcccagcctggagattcaggagatcaatgcctccaactccaaacagcccatccac
atggtctacgtcccttcccatctctaccacatgctctttgaactcttcaagaatgccatg
cgggcgactgtggagagccatgagtccagcctcacactgccacccatcaaggtgatggtg
gccttgggtgaggaagatctgtctatcaaaatgagtgaccggggtgggggagttcctttg
cgaaagattgagagactcttcagctacatgtactcaacagctcccacccctcagccaggc
tccggagggactcctttggctggttttggctacggactccccatatctcgcctctatgcc
aagtacttccagggtgacctgcagctcttctccatggagggcttcgggactgacgctgtc
atctatctaaaggccctgtcaacagattctgtggagcgcttgcctgtctacaacaagtca
gcctggcgtcactaccagaccatccaggaggccggcgactggtgtgtgcccagcacggag
cccaagaacacatccacctaccgagtcagctaa

DBGET integrated database retrieval system