KEGG   Sarcophilus harrisii (Tasmanian devil): 100924271Help
Entry
100924271         CDS       T02286                                 

Gene name
ELP3
Definition
elongator acetyltransferase complex subunit 3
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100924271 (ELP3)
Transfer RNA biogenesis [BR:shr03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    100924271 (ELP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 548 aa AA seqDB search
MKEKRKGDLSPAELMILTIGDVIKQLIEAHQQGKDIDLNKVKTRTAAKYGLSSQPRLVDI
IAAVPPQYRKILVPKLKAKPIRTASGIAVVAVMCKPHRCPHINFTGNICVYCPGGPDSDF
EYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIDQLKQLGHSVDKVEFIVMGGTFMALSEE
YRDYFIRNLHDALSGHTSNSVSEAVRYSERSLTKCIGITIETRPDYCLKKHLSDMLSYGC
TRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDAGFKVVAHMMPDLPNVGLERDIEQ
FIEFFENPAFRPDGMKLYPTLVIRGTGLYELWKSGRYKSYSPSCLVELVARILALVPPWT
RVYRVQRDIPMPLVSSGVEHGNLRELAFARMKDLGIQCRDVRTREVGIQEIHHKVRPYQV
ELVRRDYVANGGWETFLSYEDPEQDILIGLLRLRKCSEESFRPELKGGVSIVRELHVYGS
VVPVSSRDPTKFQHQGFGIRVEGSLVVRQAHFSSQLSFFSVISGVGTRNYYRKIGYVLEG
PYMVKKLI
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagaaacggaaaggagatctcagtcctgctgagctgatgatcctgaccataggt
gatgttattaaacaattgattgaagcccatcaacaggggaaagatattgatctaaataaa
gtgaaaaccagaacagctgccaaatatggcctttcatcccaacctcgactggtagatatc
attgctgcagtcccacctcaatatcggaaaatcttggtgcccaagttaaaagcaaaacca
attagaactgccagtgggattgctgttgtggctgtgatgtgcaagcctcatagatgtcca
catattaattttacaggaaatatatgtgtttactgtcctggtggacctgactcagatttt
gagtattcaactcaatcttatacaggatatgagccaacttccatgcgagctatccgtgcc
agatatgacccttttctccagacaagacatcgaatagaccagttgaaacaactaggtcac
agtgtggataaggtagaattcattgtgatgggtggaacatttatggccctctcagaagag
tacagagattattttatccgaaatttgcatgatgccttatctggacatacttcaaacagt
gtatctgaagcagtcaggtactctgaaagaagcctcacaaaatgcattggtatcaccatt
gagacacgaccagattattgcttgaagaagcatttgagtgatatgttatcctatggctgt
acaagattggagattggagtgcaaagtgtttatgaagatgtagccagagataccaacagg
gggcacacagtaaaggcagtgtgtgaatcatttcatctggctaaggatgcaggtttcaaa
gttgtggcccatatgatgccagatttgccaaatgtgggattagaaagagacattgagcag
tttatagagttttttgagaaccccgccttccgccctgatggtatgaagctctatcctaca
ctggtaatacgtggaactggtctttatgagctttggaaatcaggaagatataagagttat
tctcctagttgccttgtggaattagtagctcgaatattggctcttgtaccaccatggaca
cgagtataccgtgttcagagagatattccaatgcctttagtcagctcaggagtagagcat
ggaaatttgagggagctcgcatttgcaagaatgaaagaccttggaatacagtgccgtgat
gtaagaaccagagaggttggaatccaggaaattcatcataaagtgaggccataccaggtt
gaattggttaggcgagattatgtggcaaatggtggctgggagactttcctatcatatgaa
gatcctgagcaggacattttgattggccttttacgtttgcggaagtgttcagaggaatca
tttcgacctgagttgaaaggaggtgtttccatagttcgtgaactacatgtatatgggagt
gtagttcctgtgagcagtcgtgaccctacaaaatttcagcatcaggggtttggcatcagg
gtagagggatccctagtagtcaggcaggcacatttttcttcccaattaagttttttctct
gtcatttcaggagttggcactaggaattactacaggaagattggctatgtcttagaagga
ccttacatggtaaagaagttgatctaa

DBGET integrated database retrieval system