KEGG   Sarcophilus harrisii (Tasmanian devil): 100924343Help
Entry
100924343         CDS       T02286                                 

Gene name
FLNA
Definition
(RefSeq) filamin A
  KO
K04437  
filamin
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100924343 (FLNA)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100924343 (FLNA)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100924343 (FLNA)
  Infectious diseases
   05132 Salmonella infection
    100924343 (FLNA)
Cytoskeleton proteins [BR:shr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100924343 (FLNA)
  Intermediate filaments
   Intermediate filament-binding proteins
    100924343 (FLNA)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100924343 (FLNA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
X
AA seq 2230 aa AA seqDB search
DAAILTPAFLSASAHLPLADTAPGPAEGVLEEVGRGTLLKMEATVGFRLGYLRGLGLGRV
SWVGRPDLWAPEGPDCSLLNVGLPTPMPEPADVFLPTPCPVDSKAIVDGNLKLILGLIWT
LILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKLPQLPITNFSRDWQSGRALGALVD
SCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQVITPEEIVDPNVDEHSVMTYLSQ
FPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKKRAEFTVETISAGQGEVLVYVEDP
AGHREEAKVIANNDKNRTFSVWYIPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDSSK
VTAQGPGLEPTGNIANKTTYFEIFTAGAGVGEVEVVIQDPTGKKGTVEQQLEDKGNSTYR
CSYKPTLEGVYTIYVTFAGIPIPRSPYTVTVGQACNPSACRAVGRGLQPKGVRVKETADF
KVYTKGAGSGELKVVVKGPKGEERVKQKDLGDGVYGFEYYPPVPGNYTVTITWGGQNISR
SPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIEC
DDRGDGSCDVRYWPQEAGEYAVHVLCNNEDIKLSPFMADIKTAPKDFYPEKVKARGPGLE
KTGVAINKPAEFTVDAKNGGKAPLKVQVQDSEGFPVDVTVKDNGNNTFSCSYVPKKAVKH
TAMISWGGVNIPNSPYRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCTEAGQGD
VSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTPRGAGSYTIMVLFANQATPTSPIR
IKVDPAHDASKVKAEGPGLSRNGVELGKPTHFTVNAKPAGKAKLDVQFTGPAKGEAVRDF
DVIDHHDNTYTVKYVPLQQGNMGVNVTYGGDHIPKSPFSVGVVQTLDLSKIKVSGLGDKV
EVGKDQEFTVKAKGAGGQGKVASKITGPSGKAVPCKVEPGLNADNSVVKFIPREEGPYEV
EVTYDGVPVPGSPFPVEAVPPTNPTKVKAFGPGLKGGSAGSPAPFTIDTKGAGTGGLGLT
VEGPCEAKIECLDNGDGTCSVSYLPTEPGDYNINILFADTHIPGSPFKAHVAPCFDPSKV
KCSGPGLERATAGEAGQFHVDCSNAGSAELTIEISSDAGMQAEVHIQDNGDGTYTITYIP
LYPGVYTITIKYGGQMVPNFPSKLLVEPAVDTTGVKCYGPGVEGKGVFREATTEFSVDAR
ALTKAGGPHIKTRVANPSGNLTDAYIQDNGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSS
PFRVSVTEGCDPSRVRVHGPGIQSGTTNQPNKFTVETRGAGTGGLGLAVEGPSEAKMSCM
DNKDGSCSVEYVPYEAGTYNLNVTYGGHQVPGSPFKVPVHDVTDSSKVKCSGPGLSPGVV
RANVPQSFQVDTSKAGVAPLQVKVQGPKGVVEPVDVVDNADGTKTVNYVPSREGPYSISV
LYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQ
ITDPEGKPKKTTIQDNQDGTYTVSYVPDMTGRYTILIKYGGDEIPLSPYRVRALPMGDAS
KCTVTGTGIGPTIQIGEETVITVDAKAAGKGKVTCTVCTPDGTEVDVDVVENEDGTFDIF
YTAPQPGKYIICVRFGGEHIPNSPFQVMALDGDQPSTQQMRAQQLAAPYSYAPGVQQPWT
AERPMVGVNGLDVAGLRPFDLVIPFTIKKGEITGEVRMPSGQVAKPSITDNKDGTVTVRY
APTEAGLHEMDIRYDSMHIPGSPLQFYVDYVNSGHVTAYGPGLTHGLVNKPAIFTVNTKD
AGEGGLSLAIEGPSKADISCTDNQDGTCTVSYLPVLPGDYSILVKYNDKHIPGSPFTAKI
TGDDSMRMSHLKVGSAADIPLNITETDISQLTATVVPPSGREEPCLLKRLRNGHVGISFV
PKEIGEHLVNVKKHGQHVPNSPITVMISQSEIGDASRVHVSGQGLHEGRTFEPAEFIIDK
ISVRDMTAQVTSPSGKPHEAEILEGENNTYCIRFVPTEMGVHTVIVKYKGQHVPGSPFQF
TVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDR
KDGSCGVSYVVQEPGRWGVGGQAVPWRATCHGGPRLVWSLMGPQSFLCPHREFPTGAVGL
APVAVGQTHN
NT seq 6693 nt NT seq  +upstreamnt  +downstreamnt
gatgctgccatcctgaccccggccttcctcagtgcctctgcccacctgcctttggcagat
acggcccctggaccagcagaaggtgtgctagaagaggtgggccgagggactctcctcaag
atggaagccacagtcgggtttcggctgggctaccttagaggtctcggcctcggaagggtc
tcctgggtagggaggcccgacctctgggcaccagaaggtcctgactgcagcctgcttaac
gtggggctacccacccccatgcccgagccggctgacgtctttcttcccaccccgtgccct
gtagacagcaaggccattgtcgatggcaacctgaagctgattttgggtctgatttggacc
ctgattctgcactattccatctcgatgccgatgtgggacgaggaggaggatgaggaggcc
aagaagcagacgcccaagcagcggctcctgggctggatccagaataagctcccccagctg
cccatcaccaacttcagtagggattggcagagcggccgcgccctcggtgccctcgtggac
agctgcgccccaggcctgtgccccgactgggactcctgggacgccagcaagcccgtgaac
aacgccagggaagccatgcagcaggccgacgactggctgggcattccgcaggtgatcact
cctgaggagattgtggaccccaatgtcgatgagcattcggtcatgacctacctgtcccag
tttcccaaggccaagctgaagcctggggccccgctgcgccccaagctcaacccaaagaaa
gccagagcctacgggccgggaatcgagcccaccggtaatatggtgaagaaacgggcggag
ttcaccgtggagacaataagtgccggccagggggaggtcctggtgtacgtggaggaccct
gctgggcaccgggaagaggccaaggtgatcgccaacaatgacaagaaccgcaccttctct
gtctggtacatccctgaggtcacagggacccacaaggtcacggttctctttgctggccag
cacatcgccaagagcccctttgaggtgtatgtggacaagtcccagggagactccagcaag
gtcacggcccaaggccccggcctggagcccactggcaacatcgccaacaagaccacctac
tttgagatcttcactgccggcgctggtgtcggagaggtggaggtagtgatccaagatccc
acggggaagaagggcaccgtggagcagcagctggaggacaagggcaacagcacgtacaga
tgtagctacaagcccaccctggagggagtctacaccatctacgtcacctttgccgggatc
cccattccccggagcccatacactgtcaccgttgggcaagcctgcaaccccagtgcctgc
cgggctgtgggccgaggtttgcagcccaaaggtgttcgagtgaaagagacggccgacttc
aaagtctacaccaaaggggcgggcagtggcgagctcaaggtcgtcgtgaagggtcccaag
ggtgaagaacgggtgaaacagaaagatctcggagatggcgtttatggctttgagtattat
ccccccgtccccggcaactacacagtcaccatcacctggggcggtcagaacatctcccgg
agtcccttcgaagtaaaggtgggcacggagtgtggcaaccagaaggttcgggcctggggc
cctggcctggagggcggtgtggtcggcaagtcggccgacttcgtggtcgaggccatcggg
gatgacgttggtaccctgggattctcagtggaaggcccctcacaggcaaagattgagtgt
gatgaccggggtgatggttcctgtgacgtgcgctattggccacaggaggctggggagtac
gcggtccacgtgctctgcaacaacgaagacatcaaactcagtccattcatggccgacatc
aagaccgcgcccaaggacttttacccagaaaaggtgaaagctcgagggccgggtctggag
aagaccggcgtggccatcaataagccggccgagttcaccgtggatgccaagaacgggggc
aaggcccctctcaaagtccaagtgcaggacagcgagggcttccctgtggatgtcaccgtg
aaagacaatggcaacaacaccttcagctgctcctatgtccccaagaaagcagtcaagcac
acggctatgatctcttggggaggagtcaacatccctaacagcccctaccgggtaaatgtg
ggagcagggagccatcctaataaggtaaaagtctatgggccaggagtggccaagaccggt
ctcaaggcccacgagccaacctatttcactgtggactgcactgaagctgggcagggtgat
gtcagcattggcatcaagtgtgccccaggagtggtggggccagctgaggcggatattgac
tttgacatcattcgaaatgacaatgacaccttcacagtcaagtacacccctcggggggca
ggcagctacaccatcatggttctgtttgccaaccaggccacacccaccagccccattcga
atcaaggtggaccctgcccacgatgccagcaaagtgaaggctgaaggccccggactgagc
aggaatggcgtggaacttggcaaacccacccacttcactgtcaacgccaagccggcggga
aaagccaagctggatgtccagttcacaggcccagccaagggagaagctgttcgggatttc
gatgtcattgatcaccatgacaacacttatactgtcaaatacgtccctttgcagcagggc
aacatgggtgtgaacgtgacctatggaggggaccatatccccaagagtcccttctctgtg
ggtgtggtccaaaccttggacctcagcaagatcaaggtgtccggcttaggagacaaagtg
gaagtcggcaaagaccaggaattcacagtcaaggccaagggagcagggggccagggcaag
gtggcgtctaagatcacgggcccttctggcaaggcggtcccctgcaaggtggagccaggc
ctgaacgcagacaacagtgtggtcaagttcatcccccgagaagagggcccctatgaagtg
gaggtgacctatgacggcgttcccgtccccgggagccctttcccggtggaggccgtgcca
ccgaccaatcccactaaggtgaaagccttcggacctggactgaagggaggcagcgccggc
tccccggcccccttcacaatcgataccaagggcgcaggcacaggaggcctcgggctgacg
gtcgaggggccgtgtgaagccaaaatcgagtgtctggacaatggggatggcacctgttcc
gtgtcctacctgcccacagaacccggggattacaacatcaacatactctttgccgacacc
cacatcccaggctcccccttcaaggcccacgtggccccctgttttgacccctccaaggtc
aagtgctccgggcctgggctggagcgtgccacagcgggtgaagcgggtcagtttcacgtg
gactgctccaatgctgggagtgcggagctcaccatcgaaatcagctcggacgcgggcatg
caggcggaggtgcacatccaagacaacggggacggcacctacactatcacctacatccct
ctctaccccggggtctacaccatcaccatcaaatacggcggccagatggtccccaacttt
cccagcaagctcctggtggagccagcagtcgacactaccggtgtcaagtgctacgggccc
ggtgtggagggcaaaggggtgttccgagaggccaccacggagttcagcgtggacgctcgg
gccctcaccaaggctgggggtccccacatcaagacacgtgtcgctaatccatcaggcaac
ctgactgatgcttacatccaggacaacggagatggaacctacaaagttgaatatacacct
tatgaggaaggggtccattcagtagatgtgacctatgatggcagccctgtacccagcagc
cccttccgagtgtctgtgaccgagggctgtgacccatcccgagtacgtgtccacgggcca
ggcatccagagtggtaccaccaaccagcccaacaaattcactgtggagaccaggggcgca
ggcacagggggcctcgggctggccgtggaaggcccatcggaggccaaaatgtcctgcatg
gacaataaggatggcagctgctccgtggagtacgtgccttatgaggcaggcacctacaac
ctcaacgtcacctatggtggccaccaagtgccaggcagccccttcaaggttcctgtgcat
gacgtcaccgactcctccaaggtgaagtgctcagggcccggactgagccctggggtggtc
cgagccaacgtccctcagtccttccaggtcgacaccagtaaggcgggcgtagccccgctc
caggtcaaggtgcaggggccgaagggggtagtggagcctgtggatgtggtagacaatgca
gacggcacaaagacggtcaactatgtgcccagccgggagggcccctacagcatctcggtg
ctctatggggatgaagaggttcctcgaagtcccttcaaggtcaaggttctgcccacccat
gatgccagcaaggtgaaggccagcggccccgggctcaacaccacgggcgtgcccgccagc
ctgcctgtagaattcactattgacgccaaggatgcgggcgaaggcctgcttgctgtccag
atcacggaccccgaagggaaacccaagaagaccacgatccaggacaaccaggacggcacc
tacaccgtgtcctacgtccccgacatgacgggcagatacacgattctcatcaagtatggg
ggtgatgagattcccttgtccccgtaccgtgtccgggccctgcccatgggggacgccagc
aagtgcacggtgacaggcaccggcatcggccccaccatccagatcggcgaggagacggtg
atcactgtggacgccaaggccgccggcaaaggcaaggttacatgcacggtgtgtacccct
gacggcacggaggtggacgtggatgtggtggagaacgaagatgggactttcgacatcttc
tacacggccccccagccgggcaaatacatcatctgcgtccgcttcgggggcgagcacatt
cccaacagccccttccaggtcatggccttggacggggatcagcccagcactcagcagatg
cgggcccagcagttggcagctccgtattcatatgcaccaggcgtccagcaaccttggaca
gcagaacggccgatggtgggcgtgaatgggctcgatgtcgctggcctgcggccttttgac
ctggtcatccccttcaccatcaaaaagggagagatcacaggagaggtccgcatgccgtcg
ggccaggtggcgaagccctccatcacggacaacaaagacggcaccgtgaccgtgcgctac
gcccccaccgaggcgggcctccacgagatggacatacgctacgacagcatgcacatccca
ggaagcccgctgcagttctacgtggactatgtcaacagtggccatgtcaccgcctacggt
ccgggcctgactcacggactagtgaacaaaccagccatcttcactgtcaataccaaggat
gcaggggaagggggcttgtccttggccatcgagggcccttcaaaggccgacatcagctgc
acagacaaccaggatggcacctgcaccgtctcatacctcccggtcctcccaggggactac
agtatcctggtgaagtataatgacaagcacatccccggcagccccttcacagccaagatc
acaggtgacgattccatgcgtatgtcccacctgaaggtgggctcggctgccgacattccc
ctcaacatcacggagaccgacatcagccagctcacggcaacggttgtgcccccgtcgggc
cgagaggagccctgcctgctcaagagattgcgcaacggccacgttgggatctcgttcgtg
cccaaagagataggagagcacctcgtgaatgtcaagaagcacgggcaacatgtccccaac
agccccatcacggtgatgatcagtcagtcggagatcggggacgccagccgggtgcacgtc
tccggccagggcctccacgaaggccggacctttgaaccagccgagttcatcattgataaa
atcagcgtccgagatatgacggcccaggtaaccagcccttcgggcaagccccacgaagcc
gagatcctggagggagagaacaacacctactgtatccgctttgtgcctaccgagatgggg
gtgcacacggtcatcgtcaagtacaaggggcaacatgtgcctggcagccccttccagttt
acagtggggcccctgggagaagggggtgcccacaaagtccgtgctggtggacctggcctg
gagagggcagaagccggagtaccagcggagttcagcatctggacgagggaggccggcgct
ggtggcctcgccattgctgttgaaggccctagcaaggctgagatctcctttgaggaccgc
aaggatggctcctgtggcgtctcctatgtggtccaagagcccggtaggtggggggtggga
gggcaggccgtgccatggcgggccacgtgtcatggtggaccacggctcgtgtggagcttg
atggggccgcagtccttcctgtgcccccacagagagttccccacaggagcggtcggcctc
gccccggttgccgttggacagactcataactga

DBGET integrated database retrieval system