KEGG   Sarcophilus harrisii (Tasmanian devil): 100924343Help
Entry
100924343         CDS       T02286                                 

Gene name
FLNA
Definition
(RefSeq) filamin A, alpha
  KO
K04437  
filamin
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100924343 (FLNA)
 Cellular Processes
  Cellular community
   04510 Focal adhesion
    100924343 (FLNA)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100924343 (FLNA)
  Infectious diseases
   05132 Salmonella infection
    100924343 (FLNA)
Cytoskeleton proteins [BR:shr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100924343 (FLNA)
  Intermediate filaments
   Intermediate filament-binding proteins
    100924343 (FLNA)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100924343 (FLNA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
X
AA seq 2230 aa AA seqDB search
DAAILTPAFLSASAHLPLADTAPGPAEGVLEEVGRGTLLKMEATVGFRLGYLRGLGLGRV
SWVGRPDLWAPEGPDCSLLNVGLPTPMPEPADVFLPTPCPVDSKAIVDGNLKLILGLIWT
LILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKLPQLPITNFSRDWQSGRALGALVD
SCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQVITPEEIVDPNVDEHSVMTYLSQ
FPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKKRAEFTVETISAGQGEVLVYVEDP
AGHREEAKVIANNDKNRTFSVWYIPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDSSK
VTAQGPGLEPTGNIANKTTYFEIFTAGAGVGEVEVVIQDPTGKKGTVEQQLEDKGNSTYR
CSYKPTLEGVYTIYVTFAGIPIPRSPYTVTVGQACNPSACRAVGRGLQPKGVRVKETADF
KVYTKGAGSGELKVVVKGPKGEERVKQKDLGDGVYGFEYYPPVPGNYTVTITWGGQNISR
SPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIEC
DDRGDGSCDVRYWPQEAGEYAVHVLCNNEDIKLSPFMADIKTAPKDFYPEKVKARGPGLE
KTGVAINKPAEFTVDAKNGGKAPLKVQVQDSEGFPVDVTVKDNGNNTFSCSYVPKKAVKH
TAMISWGGVNIPNSPYRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCTEAGQGD
VSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTPRGAGSYTIMVLFANQATPTSPIR
IKVDPAHDASKVKAEGPGLSRNGVELGKPTHFTVNAKPAGKAKLDVQFTGPAKGEAVRDF
DVIDHHDNTYTVKYVPLQQGNMGVNVTYGGDHIPKSPFSVGVVQTLDLSKIKVSGLGDKV
EVGKDQEFTVKAKGAGGQGKVASKITGPSGKAVPCKVEPGLNADNSVVKFIPREEGPYEV
EVTYDGVPVPGSPFPVEAVPPTNPTKVKAFGPGLKGGSAGSPAPFTIDTKGAGTGGLGLT
VEGPCEAKIECLDNGDGTCSVSYLPTEPGDYNINILFADTHIPGSPFKAHVAPCFDPSKV
KCSGPGLERATAGEAGQFHVDCSNAGSAELTIEISSDAGMQAEVHIQDNGDGTYTITYIP
LYPGVYTITIKYGGQMVPNFPSKLLVEPAVDTTGVKCYGPGVEGKGVFREATTEFSVDAR
ALTKAGGPHIKTRVANPSGNLTDAYIQDNGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSS
PFRVSVTEGCDPSRVRVHGPGIQSGTTNQPNKFTVETRGAGTGGLGLAVEGPSEAKMSCM
DNKDGSCSVEYVPYEAGTYNLNVTYGGHQVPGSPFKVPVHDVTDSSKVKCSGPGLSPGVV
RANVPQSFQVDTSKAGVAPLQVKVQGPKGVVEPVDVVDNADGTKTVNYVPSREGPYSISV
LYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQ
ITDPEGKPKKTTIQDNQDGTYTVSYVPDMTGRYTILIKYGGDEIPLSPYRVRALPMGDAS
KCTVTGTGIGPTIQIGEETVITVDAKAAGKGKVTCTVCTPDGTEVDVDVVENEDGTFDIF
YTAPQPGKYIICVRFGGEHIPNSPFQVMALDGDQPSTQQMRAQQLAAPYSYAPGVQQPWT
AERPMVGVNGLDVAGLRPFDLVIPFTIKKGEITGEVRMPSGQVAKPSITDNKDGTVTVRY
APTEAGLHEMDIRYDSMHIPGSPLQFYVDYVNSGHVTAYGPGLTHGLVNKPAIFTVNTKD
AGEGGLSLAIEGPSKADISCTDNQDGTCTVSYLPVLPGDYSILVKYNDKHIPGSPFTAKI
TGDDSMRMSHLKVGSAADIPLNITETDISQLTATVVPPSGREEPCLLKRLRNGHVGISFV
PKEIGEHLVNVKKHGQHVPNSPITVMISQSEIGDASRVHVSGQGLHEGRTFEPAEFIIDK
ISVRDMTAQVTSPSGKPHEAEILEGENNTYCIRFVPTEMGVHTVIVKYKGQHVPGSPFQF
TVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDR
KDGSCGVSYVVQEPGRWGVGGQAVPWRATCHGGPRLVWSLMGPQSFLCPHREFPTGAVGL
APVAVGQTHN
NT seq 6693 nt NT seq  +upstreamnt  +downstreamnt
gatgctgccatcctgaccccggccttcctcagtgcctctgcccacctgcctttggcagat
acggcccctggaccagcagaaggtgtgctagaagaggtgggccgagggactctcctcaag
atggaagccacagtcgggtttcggctgggctaccttagaggtctcggcctcggaagggtc
tcctgggtagggaggcccgacctctgggcaccagaaggtcctgactgcagcctgcttaac
gtggggctacccacccccatgcccgagccggctgacgtctttcttcccaccccgtgccct
gtagacagcaaggccattgtcgatggcaacctgaagctgattttgggtctgatttggacc
ctgattctgcactattccatctcgatgccgatgtgggacgaggaggaggatgaggaggcc
aagaagcagacgcccaagcagcggctcctgggctggatccagaataagctcccccagctg
cccatcaccaacttcagtagggattggcagagcggccgcgccctcggtgccctcgtggac
agctgcgccccaggcctgtgccccgactgggactcctgggacgccagcaagcccgtgaac
aacgccagggaagccatgcagcaggccgacgactggctgggcattccgcaggtgatcact
cctgaggagattgtggaccccaatgtcgatgagcattcggtcatgacctacctgtcccag
tttcccaaggccaagctgaagcctggggccccgctgcgccccaagctcaacccaaagaaa
gccagagcctacgggccgggaatcgagcccaccggtaatatggtgaagaaacgggcggag
ttcaccgtggagacaataagtgccggccagggggaggtcctggtgtacgtggaggaccct
gctgggcaccgggaagaggccaaggtgatcgccaacaatgacaagaaccgcaccttctct
gtctggtacatccctgaggtcacagggacccacaaggtcacggttctctttgctggccag
cacatcgccaagagcccctttgaggtgtatgtggacaagtcccagggagactccagcaag
gtcacggcccaaggccccggcctggagcccactggcaacatcgccaacaagaccacctac
tttgagatcttcactgccggcgctggtgtcggagaggtggaggtagtgatccaagatccc
acggggaagaagggcaccgtggagcagcagctggaggacaagggcaacagcacgtacaga
tgtagctacaagcccaccctggagggagtctacaccatctacgtcacctttgccgggatc
cccattccccggagcccatacactgtcaccgttgggcaagcctgcaaccccagtgcctgc
cgggctgtgggccgaggtttgcagcccaaaggtgttcgagtgaaagagacggccgacttc
aaagtctacaccaaaggggcgggcagtggcgagctcaaggtcgtcgtgaagggtcccaag
ggtgaagaacgggtgaaacagaaagatctcggagatggcgtttatggctttgagtattat
ccccccgtccccggcaactacacagtcaccatcacctggggcggtcagaacatctcccgg
agtcccttcgaagtaaaggtgggcacggagtgtggcaaccagaaggttcgggcctggggc
cctggcctggagggcggtgtggtcggcaagtcggccgacttcgtggtcgaggccatcggg
gatgacgttggtaccctgggattctcagtggaaggcccctcacaggcaaagattgagtgt
gatgaccggggtgatggttcctgtgacgtgcgctattggccacaggaggctggggagtac
gcggtccacgtgctctgcaacaacgaagacatcaaactcagtccattcatggccgacatc
aagaccgcgcccaaggacttttacccagaaaaggtgaaagctcgagggccgggtctggag
aagaccggcgtggccatcaataagccggccgagttcaccgtggatgccaagaacgggggc
aaggcccctctcaaagtccaagtgcaggacagcgagggcttccctgtggatgtcaccgtg
aaagacaatggcaacaacaccttcagctgctcctatgtccccaagaaagcagtcaagcac
acggctatgatctcttggggaggagtcaacatccctaacagcccctaccgggtaaatgtg
ggagcagggagccatcctaataaggtaaaagtctatgggccaggagtggccaagaccggt
ctcaaggcccacgagccaacctatttcactgtggactgcactgaagctgggcagggtgat
gtcagcattggcatcaagtgtgccccaggagtggtggggccagctgaggcggatattgac
tttgacatcattcgaaatgacaatgacaccttcacagtcaagtacacccctcggggggca
ggcagctacaccatcatggttctgtttgccaaccaggccacacccaccagccccattcga
atcaaggtggaccctgcccacgatgccagcaaagtgaaggctgaaggccccggactgagc
aggaatggcgtggaacttggcaaacccacccacttcactgtcaacgccaagccggcggga
aaagccaagctggatgtccagttcacaggcccagccaagggagaagctgttcgggatttc
gatgtcattgatcaccatgacaacacttatactgtcaaatacgtccctttgcagcagggc
aacatgggtgtgaacgtgacctatggaggggaccatatccccaagagtcccttctctgtg
ggtgtggtccaaaccttggacctcagcaagatcaaggtgtccggcttaggagacaaagtg
gaagtcggcaaagaccaggaattcacagtcaaggccaagggagcagggggccagggcaag
gtggcgtctaagatcacgggcccttctggcaaggcggtcccctgcaaggtggagccaggc
ctgaacgcagacaacagtgtggtcaagttcatcccccgagaagagggcccctatgaagtg
gaggtgacctatgacggcgttcccgtccccgggagccctttcccggtggaggccgtgcca
ccgaccaatcccactaaggtgaaagccttcggacctggactgaagggaggcagcgccggc
tccccggcccccttcacaatcgataccaagggcgcaggcacaggaggcctcgggctgacg
gtcgaggggccgtgtgaagccaaaatcgagtgtctggacaatggggatggcacctgttcc
gtgtcctacctgcccacagaacccggggattacaacatcaacatactctttgccgacacc
cacatcccaggctcccccttcaaggcccacgtggccccctgttttgacccctccaaggtc
aagtgctccgggcctgggctggagcgtgccacagcgggtgaagcgggtcagtttcacgtg
gactgctccaatgctgggagtgcggagctcaccatcgaaatcagctcggacgcgggcatg
caggcggaggtgcacatccaagacaacggggacggcacctacactatcacctacatccct
ctctaccccggggtctacaccatcaccatcaaatacggcggccagatggtccccaacttt
cccagcaagctcctggtggagccagcagtcgacactaccggtgtcaagtgctacgggccc
ggtgtggagggcaaaggggtgttccgagaggccaccacggagttcagcgtggacgctcgg
gccctcaccaaggctgggggtccccacatcaagacacgtgtcgctaatccatcaggcaac
ctgactgatgcttacatccaggacaacggagatggaacctacaaagttgaatatacacct
tatgaggaaggggtccattcagtagatgtgacctatgatggcagccctgtacccagcagc
cccttccgagtgtctgtgaccgagggctgtgacccatcccgagtacgtgtccacgggcca
ggcatccagagtggtaccaccaaccagcccaacaaattcactgtggagaccaggggcgca
ggcacagggggcctcgggctggccgtggaaggcccatcggaggccaaaatgtcctgcatg
gacaataaggatggcagctgctccgtggagtacgtgccttatgaggcaggcacctacaac
ctcaacgtcacctatggtggccaccaagtgccaggcagccccttcaaggttcctgtgcat
gacgtcaccgactcctccaaggtgaagtgctcagggcccggactgagccctggggtggtc
cgagccaacgtccctcagtccttccaggtcgacaccagtaaggcgggcgtagccccgctc
caggtcaaggtgcaggggccgaagggggtagtggagcctgtggatgtggtagacaatgca
gacggcacaaagacggtcaactatgtgcccagccgggagggcccctacagcatctcggtg
ctctatggggatgaagaggttcctcgaagtcccttcaaggtcaaggttctgcccacccat
gatgccagcaaggtgaaggccagcggccccgggctcaacaccacgggcgtgcccgccagc
ctgcctgtagaattcactattgacgccaaggatgcgggcgaaggcctgcttgctgtccag
atcacggaccccgaagggaaacccaagaagaccacgatccaggacaaccaggacggcacc
tacaccgtgtcctacgtccccgacatgacgggcagatacacgattctcatcaagtatggg
ggtgatgagattcccttgtccccgtaccgtgtccgggccctgcccatgggggacgccagc
aagtgcacggtgacaggcaccggcatcggccccaccatccagatcggcgaggagacggtg
atcactgtggacgccaaggccgccggcaaaggcaaggttacatgcacggtgtgtacccct
gacggcacggaggtggacgtggatgtggtggagaacgaagatgggactttcgacatcttc
tacacggccccccagccgggcaaatacatcatctgcgtccgcttcgggggcgagcacatt
cccaacagccccttccaggtcatggccttggacggggatcagcccagcactcagcagatg
cgggcccagcagttggcagctccgtattcatatgcaccaggcgtccagcaaccttggaca
gcagaacggccgatggtgggcgtgaatgggctcgatgtcgctggcctgcggccttttgac
ctggtcatccccttcaccatcaaaaagggagagatcacaggagaggtccgcatgccgtcg
ggccaggtggcgaagccctccatcacggacaacaaagacggcaccgtgaccgtgcgctac
gcccccaccgaggcgggcctccacgagatggacatacgctacgacagcatgcacatccca
ggaagcccgctgcagttctacgtggactatgtcaacagtggccatgtcaccgcctacggt
ccgggcctgactcacggactagtgaacaaaccagccatcttcactgtcaataccaaggat
gcaggggaagggggcttgtccttggccatcgagggcccttcaaaggccgacatcagctgc
acagacaaccaggatggcacctgcaccgtctcatacctcccggtcctcccaggggactac
agtatcctggtgaagtataatgacaagcacatccccggcagccccttcacagccaagatc
acaggtgacgattccatgcgtatgtcccacctgaaggtgggctcggctgccgacattccc
ctcaacatcacggagaccgacatcagccagctcacggcaacggttgtgcccccgtcgggc
cgagaggagccctgcctgctcaagagattgcgcaacggccacgttgggatctcgttcgtg
cccaaagagataggagagcacctcgtgaatgtcaagaagcacgggcaacatgtccccaac
agccccatcacggtgatgatcagtcagtcggagatcggggacgccagccgggtgcacgtc
tccggccagggcctccacgaaggccggacctttgaaccagccgagttcatcattgataaa
atcagcgtccgagatatgacggcccaggtaaccagcccttcgggcaagccccacgaagcc
gagatcctggagggagagaacaacacctactgtatccgctttgtgcctaccgagatgggg
gtgcacacggtcatcgtcaagtacaaggggcaacatgtgcctggcagccccttccagttt
acagtggggcccctgggagaagggggtgcccacaaagtccgtgctggtggacctggcctg
gagagggcagaagccggagtaccagcggagttcagcatctggacgagggaggccggcgct
ggtggcctcgccattgctgttgaaggccctagcaaggctgagatctcctttgaggaccgc
aaggatggctcctgtggcgtctcctatgtggtccaagagcccggtaggtggggggtggga
gggcaggccgtgccatggcgggccacgtgtcatggtggaccacggctcgtgtggagcttg
atggggccgcagtccttcctgtgcccccacagagagttccccacaggagcggtcggcctc
gccccggttgccgttggacagactcataactga

DBGET integrated database retrieval system