KEGG   Sarcophilus harrisii (Tasmanian devil): 100924343Help
Entry
100924343         CDS       T02286                                 

Definition
filamin-A-like
Orthology
K04437  
filamin
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100924343
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100924343
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100924343
  Infectious diseases
   05132 Salmonella infection
    100924343
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100924343
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
X
AA seq 2531 aa AA seqDB search
DAAILTPAFLSASAHLPLADTAPGPAEGVLEEVGRGTLLKMEATVGFRLGYLRGLGLGRV
SWVGRPDLWAPEGPDCSLLNVGLPTPMPEPADSKAIVDGNLKLILGLIWTLILHYSISMP
MWDEEEDEEAKKQTPKQRLLGWIQNKLPQLPITNFSRDWQSGRALGALVDSCAPGLCPDW
DSWDASKPVNNAREAMQQADDWLGIPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGA
PLRPKLNPKKARAYGPGIEPTGNMVKKRAEFTVETISAGQGEVLVYVEDPAGHREEAKVI
ANNDKNRTFSVWYIPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDSSKVTAQGPGLEP
TGNIANKTTYFEIFTAGAGVGEVEVVIQDPTGKKGTVEQQLEDKGNSTYRCSYKPTLEGV
YTIYVTFAGIPIPRSPYTVTVGQACNPSACRAVGRGLQPKGVRVKETADFKVYTKGAGSG
ELKVVVKGPKGEERVKQKDLGDGVYGFEYYPPVPGNYTVTITWGGQNISRSPFEVKVGTE
CGNQKVRAWGPGLEGGVVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDRGDGSCDV
RYWPQEAGEYAVHVLCNNEDIKLSPFMADIKTAPKDFYPEKVKARGPGLEKTGVAINKPA
EFTVDAKNGGKAPLKVQVQDSEGFPVDVTVKDNGNNTFSCSYVPKKAVKHTAMISWGGVN
IPNSPYRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPG
VVGPAEADIDFDIIRNDNDTFTVKYTPRGAGSYTIMVLFANQATPTSPIRIKVDPAHDAS
KVKAEGPGLSRNGVELGKPTHFTVNAKPAGKAKLDVQFTGPAKGEAVRDFDVIDHHDNTY
TVKYVPLQQGNMGVNVTYGGDHIPKSPFSVGVVQTLDLSKIKVSGLGDKVEVGKDQEFTV
KAKGAGGQGKVASKITGPSGKAVPCKVEPGLNADNSVVKFIPREEGPYEVEVTYDGVPVP
GSPFPVEAVPPTNPTKVKAFGPGLKGGSAGSPAPFTIDTKGAGTGGLGLTVEGPCEAKIE
CLDNGDGTCSVSYLPTEPGDYNINILFADTHIPGSPFKAHVAPCFDPSKVKCSGPGLERA
TAGEAGQFHVDCSNAGSAELTIEISSDAGMQAEVHIQDNGDGTYTITYIPLYPGVYTITI
KYGGQMVPNFPSKLLVEPAVDTTGVKCYGPGVEGKGVFREATTEFSVDARALTKAGGPHI
KTRVANPSGNLTDAYIQDNGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSSPFRVSVTEGC
DPSRVRVHGPGIQSGTTNQPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVE
YVPYEAGTYNLNVTYGGHQVPGSPFKVPVHDVTDSSKVKCSGPGLSPGVVRANVPQSFQV
DTSKAGVAPLQVKVQGPKGVVEPVDVVDNADGTKTVNYVPSREGPYSISVLYGDEEVPRS
PFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKK
TTIQDNQDGTYTVSYVPDMTGRYTILIKYGGDEIPLSPYRVRALPMGDASKCTVTVSIGG
HGLGTGIGPTIQIGEETVITVDAKAAGKGKVTCTVCTPDGTEVDVDVVENEDGTFDIFYT
APQPGKYIICVRFGGEHIPNSPFQVMALDGDQPSTQQMRAQQLAAPYSYAPGVQQPWTAE
RPMVGVNGLDVAGLRPFDLVIPFTIKKGEITGEVRMPSGQVAKPSITDNKDGTVTVRYAP
TEAGLHEMDIRYDSMHIPGSPLQFYVDYVNSGHVTAYGPGLTHGLVNKPAIFTVNTKDAG
EGGLSLAIEGPSKADISCTDNQDGTCTVSYLPVLPGDYSILVKYNDKHIPGSPFTAKITG
DDSMRMSHLKVGSAADIPLNITETDISQLTATVVPPSGREEPCLLKRLRNGHVGISFVPK
EIGEHLVNVKKHGQHVPNSPITVMISQSEIGDASRVHVSGQGLHEGRTFEPAEFIIDTXX
HLFSLPTEISVRDMTAQVTSPSGKPHEAEILEGENNTYCIRFVPTEMGVHTVIVKYKGQH
VPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSK
AEISFEDRKDGSCGVSYVVQEPGSRSSCLSAHPPSPSVPLCHPLLSAPKPTXPPDGLXPP
VLXFQESGLKVNQPASFAVSLNGATGVIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRE
NGIYLIDVKFNGSHIPDSPFKIRVGEPGQGGDPGMVSAYGAGLEGGVTGSPAEFIINTSG
AGAGALSVTIDGPSKVKMDCQECSEGYRVTYTPMAPGSYLISIKYGGPYHIVGSPFKAKV
TGPRLVSSHSLHETSSVFVDSVTKGEAPLQSRALPKLHSDASKVVAKGLGLSKAFVGQKN
SFTVDCSKAGNNILMVGVQGPKTPCEEILVKHVSGGLYTITYLLKEKGDYTLMVMWGEEH
IPGSPYHITMP
NT seq 7596 nt NT seq  +upstreamnt  +downstreamnt
gatgctgccatcctgaccccggccttcctcagtgcctctgcccacctgcctttggcagat
acggcccctggaccagcagaaggtgtgctagaagaggtgggccgagggactctcctcaag
atggaagccacagtcgggtttcggctgggctaccttagaggtctcggcctcggaagggtc
tcctgggtagggaggcccgacctctgggcaccagaaggtcctgactgcagcctgcttaac
gtggggctacccacccccatgcccgagccggctgacagcaaggccattgtcgatggcaac
ctgaagctgattttgggtctgatttggaccctgattctgcactattccatctcgatgccg
atgtgggacgaggaggaggatgaggaggccaagaagcagacgcccaagcagcggctcctg
ggctggatccagaataagctcccccagctgcccatcaccaacttcagtagggattggcag
agcggccgcgccctcggtgccctcgtggacagctgcgccccaggcctgtgccccgactgg
gactcctgggacgccagcaagcccgtgaacaacgccagggaagccatgcagcaggccgac
gactggctgggcattccgcaggtgatcactcctgaggagattgtggaccccaatgtcgat
gagcattcggtcatgacctacctgtcccagtttcccaaggccaagctgaagcctggggcc
ccgctgcgccccaagctcaacccaaagaaagccagagcctacgggccgggaatcgagccc
accggtaatatggtgaagaaacgggcggagttcaccgtggagacaataagtgccggccag
ggggaggtcctggtgtacgtggaggaccctgctgggcaccgggaagaggccaaggtgatc
gccaacaatgacaagaaccgcaccttctctgtctggtacatccctgaggtcacagggacc
cacaaggtcacggttctctttgctggccagcacatcgccaagagcccctttgaggtgtat
gtggacaagtcccagggagactccagcaaggtcacggcccaaggccccggcctggagccc
actggcaacatcgccaacaagaccacctactttgagatcttcactgccggcgctggtgtc
ggagaggtggaggtagtgatccaagatcccacggggaagaagggcaccgtggagcagcag
ctggaggacaagggcaacagcacgtacagatgtagctacaagcccaccctggagggagtc
tacaccatctacgtcacctttgccgggatccccattccccggagcccatacactgtcacc
gttgggcaagcctgcaaccccagtgcctgccgggctgtgggccgaggtttgcagcccaaa
ggtgttcgagtgaaagagacggccgacttcaaagtctacaccaaaggggcgggcagtggc
gagctcaaggtcgtcgtgaagggtcccaagggtgaagaacgggtgaaacagaaagatctc
ggagatggcgtttatggctttgagtattatccccccgtccccggcaactacacagtcacc
atcacctggggcggtcagaacatctcccggagtcccttcgaagtaaaggtgggcacggag
tgtggcaaccagaaggttcgggcctggggccctggcctggagggcggtgtggtcggcaag
tcggccgacttcgtggtcgaggccatcggggatgacgttggtaccctgggattctcagtg
gaaggcccctcacaggcaaagattgagtgtgatgaccggggtgatggttcctgtgacgtg
cgctattggccacaggaggctggggagtacgcggtccacgtgctctgcaacaacgaagac
atcaaactcagtccattcatggccgacatcaagaccgcgcccaaggacttttacccagaa
aaggtgaaagctcgagggccgggtctggagaagaccggcgtggccatcaataagccggcc
gagttcaccgtggatgccaagaacgggggcaaggcccctctcaaagtccaagtgcaggac
agcgagggcttccctgtggatgtcaccgtgaaagacaatggcaacaacaccttcagctgc
tcctatgtccccaagaaagcagtcaagcacacggctatgatctcttggggaggagtcaac
atccctaacagcccctaccgggtaaatgtgggagcagggagccatcctaataaggtaaaa
gtctatgggccaggagtggccaagaccggtctcaaggcccacgagccaacctatttcact
gtggactgcactgaagctgggcagggtgatgtcagcattggcatcaagtgtgccccagga
gtggtggggccagctgaggcggatattgactttgacatcattcgaaatgacaatgacacc
ttcacagtcaagtacacccctcggggggcaggcagctacaccatcatggttctgtttgcc
aaccaggccacacccaccagccccattcgaatcaaggtggaccctgcccacgatgccagc
aaagtgaaggctgaaggccccggactgagcaggaatggcgtggaacttggcaaacccacc
cacttcactgtcaacgccaagccggcgggaaaagccaagctggatgtccagttcacaggc
ccagccaagggagaagctgttcgggatttcgatgtcattgatcaccatgacaacacttat
actgtcaaatacgtccctttgcagcagggcaacatgggtgtgaacgtgacctatggaggg
gaccatatccccaagagtcccttctctgtgggtgtggtccaaaccttggacctcagcaag
atcaaggtgtccggcttaggagacaaagtggaagtcggcaaagaccaggaattcacagtc
aaggccaagggagcagggggccagggcaaggtggcgtctaagatcacgggcccttctggc
aaggcggtcccctgcaaggtggagccaggcctgaacgcagacaacagtgtggtcaagttc
atcccccgagaagagggcccctatgaagtggaggtgacctatgacggcgttcccgtcccc
gggagccctttcccggtggaggccgtgccaccgaccaatcccactaaggtgaaagccttc
ggacctggactgaagggaggcagcgccggctccccggcccccttcacaatcgataccaag
ggcgcaggcacaggaggcctcgggctgacggtcgaggggccgtgtgaagccaaaatcgag
tgtctggacaatggggatggcacctgttccgtgtcctacctgcccacagaacccggggat
tacaacatcaacatactctttgccgacacccacatcccaggctcccccttcaaggcccac
gtggccccctgttttgacccctccaaggtcaagtgctccgggcctgggctggagcgtgcc
acagcgggtgaagcgggtcagtttcacgtggactgctccaatgctgggagtgcggagctc
accatcgaaatcagctcggacgcgggcatgcaggcggaggtgcacatccaagacaacggg
gacggcacctacactatcacctacatccctctctaccccggggtctacaccatcaccatc
aaatacggcggccagatggtccccaactttcccagcaagctcctggtggagccagcagtc
gacactaccggtgtcaagtgctacgggcccggtgtggagggcaaaggggtgttccgagag
gccaccacggagttcagcgtggacgctcgggccctcaccaaggctgggggtccccacatc
aagacacgtgtcgctaatccatcaggcaacctgactgatgcttacatccaggacaacgga
gatggaacctacaaagttgaatatacaccttatgaggaaggggtccattcagtagatgtg
acctatgatggcagccctgtacccagcagccccttccgagtgtctgtgaccgagggctgt
gacccatcccgagtacgtgtccacgggccaggcatccagagtggtaccaccaaccagccc
aacaaattcactgtggagaccaggggcgcaggcacagggggcctcgggctggccgtggaa
ggcccatcggaggccaaaatgtcctgcatggacaataaggatggcagctgctccgtggag
tacgtgccttatgaggcaggcacctacaacctcaacgtcacctatggtggccaccaagtg
ccaggcagccccttcaaggttcctgtgcatgacgtcaccgactcctccaaggtgaagtgc
tcagggcccggactgagccctggggtggtccgagccaacgtccctcagtccttccaggtc
gacaccagtaaggcgggcgtagccccgctccaggtcaaggtgcaggggccgaagggggta
gtggagcctgtggatgtggtagacaatgcagacggcacaaagacggtcaactatgtgccc
agccgggagggcccctacagcatctcggtgctctatggggatgaagaggttcctcgaagt
cccttcaaggtcaaggttctgcccacccatgatgccagcaaggtgaaggccagcggcccc
gggctcaacaccacgggcgtgcccgccagcctgcctgtagaattcactattgacgccaag
gatgcgggcgaaggcctgcttgctgtccagatcacggaccccgaagggaaacccaagaag
accacgatccaggacaaccaggacggcacctacaccgtgtcctacgtccccgacatgacg
ggcagatacacgattctcatcaagtatgggggtgatgagattcccttgtccccgtaccgt
gtccgggccctgcccatgggggacgccagcaagtgcacggtgacagtgtcaatcggaggt
cacgggctaggcaccggcatcggccccaccatccagatcggcgaggagacggtgatcact
gtggacgccaaggccgccggcaaaggcaaggttacatgcacggtgtgtacccctgacggc
acggaggtggacgtggatgtggtggagaacgaagatgggactttcgacatcttctacacg
gccccccagccgggcaaatacatcatctgcgtccgcttcgggggcgagcacattcccaac
agccccttccaggtcatggccttggacggggatcagcccagcactcagcagatgcgggcc
cagcagttggcagctccgtattcatatgcaccaggcgtccagcaaccttggacagcagaa
cggccgatggtgggcgtgaatgggctcgatgtcgctggcctgcggccttttgacctggtc
atccccttcaccatcaaaaagggagagatcacaggagaggtccgcatgccgtcgggccag
gtggcgaagccctccatcacggacaacaaagacggcaccgtgaccgtgcgctacgccccc
accgaggcgggcctccacgagatggacatacgctacgacagcatgcacatcccaggaagc
ccgctgcagttctacgtggactatgtcaacagtggccatgtcaccgcctacggtccgggc
ctgactcacggactagtgaacaaaccagccatcttcactgtcaataccaaggatgcaggg
gaagggggcttgtccttggccatcgagggcccttcaaaggccgacatcagctgcacagac
aaccaggatggcacctgcaccgtctcatacctcccggtcctcccaggggactacagtatc
ctggtgaagtataatgacaagcacatccccggcagccccttcacagccaagatcacaggt
gacgattccatgcgtatgtcccacctgaaggtgggctcggctgccgacattcccctcaac
atcacggagaccgacatcagccagctcacggcaacggttgtgcccccgtcgggccgagag
gagccctgcctgctcaagagattgcgcaacggccacgttgggatctcgttcgtgcccaaa
gagataggagagcacctcgtgaatgtcaagaagcacgggcaacatgtccccaacagcccc
atcacggtgatgatcagtcagtcggagatcggggacgccagccgggtgcacgtctccggc
cagggcctccacgaaggccggacctttgaaccagccgagttcatcattgatacnnnnnnn
catctcttctctttgcccacagaaatcagcgtccgagatatgacggcccaggtaaccagc
ccttcgggcaagccccacgaagccgagatcctggagggagagaacaacacctactgtatc
cgctttgtgcctaccgagatgggggtgcacacggtcatcgtcaagtacaaggggcaacat
gtgcctggcagccccttccagtttacagtggggcccctgggagaagggggtgcccacaaa
gtccgtgctggtggacctggcctggagagggcagaagccggagtaccagcggagttcagc
atctggacgagggaggccggcgctggtggcctcgccattgctgttgaaggccctagcaag
gctgagatctcctttgaggaccgcaaggatggctcctgtggcgtctcctatgtggtccaa
gagcccggtagccgctcttcctgcctctctgctcaccccccttccccttccgtccctctg
tgccatccccttctgtctgcccccaaaccaacctgaccccctgatgggctctaaccacct
gtgctgtgattccaggagtcaggtttaaaggtcaaccagccagcctcttttgcagtcagc
ctgaatggggccacgggcgtcattgatgccaaggtccacagcccctcgggggccctggag
gaatgctacgtcaccgagattgaccaagataagtatgccgtgcgcttcatcccccgagag
aacggcatctacctgatcgatgtcaaattcaacggctcccacatccccgacagccccttc
aagatccgcgtgggagagccggggcaaggaggggatccaggcatggtatccgcctatggg
gcgggcctcgaaggtggggtcacagggagcccagcggagttcatcatcaacaccagcggc
gccggagctggtgccttatctgtcaccatcgatggcccctccaaggtgaaaatggattgt
caggagtgctccgagggctaccgggtgacctacacgcccatggcgcctggcagttacctc
atctccatcaagtatggaggcccctaccacatcgtgggcagccctttcaaggccaaagtc
acaggtccccgactggtcagcagccacagtctccacgagacgtcatcggtgtttgtcgac
tcggtaaccaaaggtgaagcgcccctgcagtcccgggccctgcccaagctccattccgat
gccagcaaggtggtggccaagggcctggggctcagcaaggcctttgtgggccagaagaac
tctttcactgtggactgcagcaaagcaggtaataatatcctcatggtgggggtccagggc
cccaagaccccctgcgaggagatcttggtgaagcacgtcagtggcggcctctacaccatc
acctacctgctcaaggagaagggcgactataccctcatggtcatgtggggcgaggagcac
atcccagggagcccctatcacatcaccatgccctga

DBGET integrated database retrieval system