KEGG   Sarcophilus harrisii (Tasmanian devil): 100924438Help
Entry
100924438         CDS       T02286                                 

Gene name
CDC25C
Definition
(RefSeq) cell division cycle 25C
  KO
K05867  
M-phase inducer phosphatase 3 [EC:3.1.3.48]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
MicroRNAs in cancer
Module
DNA damage-induced cell cycle checkpoints
Cell cycle - G2/M transition
Brite
KEGG Orthology (KO) [BR:shr00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100924438 (CDC25C)
   04114 Oocyte meiosis
    100924438 (CDC25C)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100924438 (CDC25C)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100924438 (CDC25C)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100924438 (CDC25C)
Protein phosphatases and associated proteins [BR:shr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100924438 (CDC25C)
 Protein Tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    100924438 (CDC25C)
DNA repair and recombination proteins [BR:shr03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    100924438 (CDC25C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 444 aa AA seqDB search
MSGTPFRSCFRSNYREKLNLLLEKDASFSFYSELPKTPSNKILIDSGNLSSLTGETPKCC
LDLSNISIEETAATQLTTPPDLDETGNLDSSEPQEVQLTELCHHQHIRKYIPVELLCSTP
SALGSFCQKTDAIGTSSSDKENENNFLEHPTQPMLRSLRLQERLRKPLLSPLSLLDNRNS
VEDEMNDLGSPITRIPLHQDGEEDCVGETSLELMEVFLDEQEVKESDVKKTVSFFDANAI
QILGENSDQRQLIGDFSKVYILPTVTGKHQDLKYINPEMVAALIWGQLQDLIEKFYIIDC
RYPYEYQGGHIQGALNLHSQEELHNFFLKKPFVPSSTQKRIIIVFHCEFSSERGPRMCRY
LREEDRALNKYPALYYPELYILKGGYRDFFLEYVELCEPQNYCPMHHQDHKTELLKCRSQ
SKAWTEERQLQEQIACLMKNGNSS
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggactcccttcagatcctgctttaggtctaactacagagagaagttgaacttg
cttttagagaaagatgcttccttttcattttactcagaacttcccaagaccccatctaac
aagatccttattgattctggaaacctcagttctttgacaggagaaactccaaagtgttgc
cttgacttgtcaaatattagtattgaggagacagctgccactcagcttaccacaccgcca
gacctcgatgaaactggtaacttggattcttcagaacctcaggaagtacagctaactgaa
ttatgtcatcatcagcatattaggaaatacattcctgtagagctgctgtgtagcactccg
agtgctctaggttccttctgccaaaagacagatgcaataggtacttcttcttcagacaaa
gaaaatgagaacaactttctggaacaccctacacagccaatgctcagatccttaagactt
caagaaagattaagaaaacccctcttgtctcctctttctctactagacaacagaaattct
gtggaagatgaaatgaatgatttgggaagccctattaccagaattccactgcatcaggat
ggagaggaagactgtgtaggggagacttcacttgagctaatggaggttttcctagatgag
caagaagtcaaggaatcagatgtaaagaagacagtttcattctttgatgctaatgccatt
cagatcttgggggaaaattctgaccagaggcagctgataggtgatttcagcaaggtgtac
atactaccaacagtgacaggaaagcatcaagatctgaagtacattaacccagagatggtg
gctgctctgatatgggggcagctgcaagacctgattgagaagttttatattattgattgc
cgttacccatatgagtatcaaggaggtcatatccagggagctctgaacctgcacagtcag
gaagaactacataatttcttcctgaagaagccttttgtcccttctagtacccagaaaaga
ataatcatcgtgtttcattgtgaattctcttcggaaagaggcccccgaatgtgccgctat
ttaagagaagaagacagagctctgaacaagtaccctgcgctatactaccctgagctgtac
atcctcaagggaggctaccgagacttcttcctggaatatgtggaactgtgtgaaccacaa
aactattgcccaatgcatcatcaggaccataaaactgagcttttgaagtgtcgcagccag
agtaaagcatggactgaagagcggcaactccaggaacagattgcttgtctcatgaagaat
gggaattcaagttga

DBGET integrated database retrieval system