KEGG   Sarcophilus harrisii (Tasmanian devil): 100924486Help
Entry
100924486         CDS       T02286                                 

Gene name
PTPN7
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 7
  KO
K18019  
tyrosine-protein phosphatase non-receptor type 7 [EC:3.1.3.48]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100924486 (PTPN7)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100924486 (PTPN7)
Protein phosphatases and associated proteins [BR:shr01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    100924486 (PTPN7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 360 aa AA seqDB search
MVQAWEECSRAQQTALPQGASMAQPPAPGSTAKKHIRLQERRGSNVALILDVSSLGAVEP
ICSVSTPRELTLHFLRTAKHPLTRWALQHQPPSPKQLEEEFSKIPPNFVNPEELDIPGHA
SKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGREKVYIATQGPMRNTVSDFW
EMVWQEEVPLIIMLTQLQEGKEKCVHYWPTEEESYGPFQIRVQDVKERPEYIVRHLTIQY
QEERRSVKHIFFSAWPDHQTPESAGPLLRLMDEIEESPDTAAKSGPIVVHCSAGIGRTGC
FIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTSEQYQFLHHTLALYAAQLPEEPNP
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggtccaggcctgggaggagtgttcccgagctcagcagacagctctgccacaaggggca
agcatggcccagcctcctgccccaggctctaccgccaagaagcacatcagactgcaggag
aggagaggctccaatgtggctctgatcctggatgtgagctctctgggggcagtggagccc
atctgctcagtgtctacaccgagagagctcaccctccacttcttaaggaccgctaagcac
cccctcacccgctgggccctgcagcaccagccacccagccccaagcagctagaggaagag
ttctcgaagattcccccaaactttgtcaatcctgaagaactggacattcctggccatgcc
tctaaggaccgatacaagaccatcttgccaaatccccagagccgtgtctgtcttgggcgg
gcacagagccaggaggatggggattacattaacgccaactacatccgaggctatgatggc
cgggagaaagtttacattgcaacccagggccccatgcgtaatactgtgtctgacttctgg
gaaatggtgtggcaagaggaggtgcccctcatcatcatgctcacccagctccaagagggc
aaagagaaatgtgttcactattggccgacagaggaggaaagctatgggccattccagata
cgggtccaggatgtgaaagaacgcccagaatatattgtccggcaccttactattcagtac
caggaggagcgtcgttcagtaaaacacatcttcttctctgcgtggcctgatcatcagacc
ccagagtcagccgggcccctcttacgcctgatggatgagatcgaggagagcccagacaca
gcagccaaatctgggcccatcgtggtccactgcagtgctgggatcggccggactggctgc
ttcattgccacacggattggctgtcaacagctcaaggctcggggagaagtagacatcctg
ggcattgtttgccagcttcggttggacagggggggcatgatccagaccagtgagcaatac
cagttcctgcaccacaccctggccctgtatgctgcccagctgcctgaggaaccaaaccca
tga

DBGET integrated database retrieval system