KEGG   Sarcophilus harrisii (Tasmanian devil): 100924557Help
Entry
100924557         CDS       T02286                                 

Gene name
KMT2A
Definition
(RefSeq) histone-lysine N-methyltransferase 2A
  KO
K09186  histone-lysine N-methyltransferase MLL1 [EC:2.1.1.43]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00310  Lysine degradation
shr04934  Cushing's syndrome
shr05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100924557 (KMT2A)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    100924557 (KMT2A)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    100924557 (KMT2A)
Enzymes [BR:shr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100924557 (KMT2A)
Transcription factors [BR:shr03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    100924557 (KMT2A)
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100924557 (KMT2A)
   HMT complexes
    MLL-HCF complex
     100924557 (KMT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET FYRC PHD FYRN zf-CXXC zf-HC5HC2H zf-HC5HC2H_2 PHD_2 Bromodomain PHD_4
Motif
Other DBs
NCBI-GeneID: 100924557
NCBI-ProteinID: XP_023355186
Ensembl: ENSSHAG00000012641
Position
3
AA seq 3900 aa AA seqDB search
ASSASSSLSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQF
LGFGSDEEVKVRSPTRSPSVKSSPRKPRGRPRSISERNSAVLSDSSPVFSPLSKPETKSG
EKIKKKDSKSGEKRRGRPPTLSSVKFKLSQGKDISDLSKGSKEDTLKKIKRTPSATFQQA
AKIKKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSSERIKTDSTPLINSQLEKP
QRVRKEKDGTPPLTKEEKAAVRQSPRRIKPVRIIPSTKRTDATIAKQLLQRAKKGAQKKI
EKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTP
NSRFSATSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEMQALSEERSNTP
DVHAPLPISQSPENDNSDRRSRRFSISERSFGSRASKKLSALQSAPQQPTSSSPPPPLLT
PPPPLQPASSIPDHASWLMPPTIPLASPFLPASAAPIQEKRKSILREPTFRWTSLKHSRS
EPQYFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSTSGSTAPAQLFSALHSGTR
FDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSNRTSAGTSSTGVSNRKRKRRVFSPIRSE
PRSPSHSMKTRSGRLSTSELSPLTPPSSVSSSLSISVSPLATSALNPTFAFPSHSLTQSG
ESSEKNQRPRKQTSTPAEPFSSSSPTPLFPWFTQSSQTERGRNKDRATEELSKERDVDKS
MEKDKNRERDREREKENKRESRKEKRKKGSEIQSSSALFPIGRVSKEKVVEDIATSSSAK
KAAGRKKSSSLDPGSDIATVALGDTTAVKTKILVKKGKGSLDKTNLELAPAAPSLEEKAR
CLSASSSSTVKHSTSSIGSMLAQADKLPVADKRVASLLRKAKAQLYKIEKSKTLKQADQP
KAQGQESDSSETSVRGPRIKHVCRRAAVALGRKRAVFPDDMPTLSALPWEEREKILSSMG
NDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGV
CTNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKESN
ITKNLVDSSQKTTPPAREDHAPKKSSEPPPRKPVEEKSEDGNVSTAGTDSKQSSTSARKT
GKQVSQPAQVIPPQPPSTAPLKKEAPKTTLSEPKKKQQPPPPPPPPPPPPPPPPPPPESV
PEQSKPKKVTPRPSIPVKQKPKEKEKPPPVSKQENGTLNILNTLSNGNSSKQKLPADGVH
RIRVDFKEDCEVENVWEMGGLGILTSVPITPRVVCFLCASSGHVEFVYCQVCCEPFHKFC
LEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPT
KKKKVWICTKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDD
DYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTVRHPAEWRLALEKE
LQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPILTEVSK
QEEQQPLDLEGVKRKMDQGGYTSVLEFSDDIVKIIQAAINSDGGQPEVKKANSMVKSFFI
RQMERVFPWFSVKKSRFWEPNKVTSNSGMLPNAVLPPSLDHNYAQWQEREENNHTEQPPL
MKKIIPAPKPKGPGEPDSPIPLHPPTPPILNTDRSREDSPELNPPPGVEDNRQCALCLTY
GDDNANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEYCQKP
GATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGFEVLRRVFV
DFEGISLRRKFLSGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTT
DARKRCVYTCKIVECRPPIVEPDINSTVEHDENRTIAHSPTSLTEIPPREIRNTAEIISP
PSPDRPLHSHTSSPCFYHVISKVPRLRMPSYSPTQRSPGCRPLPSAGSPTPTTHEIVTVG
DPLLSSGLRSIGSRRHSTSSLSPQRSKFRIMSPMRAGNAYSRHSVSSISGIGAPADHDSN
VKTIDHFLGSLNPSTPNILGQNTPASSSSQRTLVTVGTKAGHMDGSPSSEMKHISAADLS
TKSSSLKGDKGKMLNSKGSEASTHVLTYPGHLKPATQVHNTTSGEVNVSKVGAFVEPSSV
SFSSKEVLSFPPLHLRGQKKERDQHTNSTQPENLSPGEDIETKALKAPGVNRSSIANEQV
MSGFRDRRQKGKKSGKETFKEKHSSKSFLDPVTVMAGEEGNLKPEFVNQVLTSEHISQRS
CNNISSEKSGDKILPISGGSKVPSVQLEGPAKESQTPRKRTVKVTLTPLKMENESPSKNT
LKEVVPVSPSQGIESATLAESSSTLESPGDGSVTQPSPNDTASQESQSNTYPNLAVQDRN
LMLQDGTKTQEDSSYKRRYPRRSARARSNMFFGLTPLYGVRSYGEEDIPFFSSSSGKKRG
KRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSSGEERLGSHNLFREEEQCDIPKISQL
DGVDDGTESDTSVTTTTRKVSQLSKRNAKENGTENSLKLDRAEDSGEKEHVIKSSAGHKT
NEPKIDNCHPVSRVKTQGQDSLEAQLSSLESGRRVHTSTPSDKNLLDSYNTELLKSDSDN
NNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLTLGEGLGLDSNRGKDMGLFE
VFSQQLPTAEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPNRMAVISDT
GEKRVTITEKSVASTESDSSLLSPGVDPTPEGHMTPDHFIQGHMDTDHIASPPCGSVEQG
HGNNQDLTRNSSTPSLQVPVSPTVPLQNQKYVPSSTDSPGPSQISNAAVQTTPPHMKPAT
EKLLVVNQNMQPLYVLQTLPNGVTQKIQLTPSVSSAPSVMESNTSVLGPMGSGLALATGL
NPSLPASQSLFPPSSKGLLPMTHHQHLHSFPAATQSSFPPNMNNPTSSLLIGVQPPPDPQ
LLVSETNQRTDLNTTATTPPPGLKKRPISRLHSRKNKKLAPSSTSSSIAPSDMVSNMTLI
NFTPSQLSNHPSLLDLGSLGNTTSHRTVPNIIKRSKSGIMYFEQAPLLPQSVGRAAASTV
GTSTIGPDSSHLTAGPVSGLASGSSVLNVVSMQATTAPTTGGSVPGHVLGQGSVTLTSPR
LLGAPDIGSISNLLIKASQQSLGLQEQPMTLPPGSGMFPQLETSQPPSTAAMTSASSICV
LPSTQTVGMTVAPSSNEPEGSYQLQHMTQLLASKTGILPSQLDVASTSGSQLSSFPQLVD
VPNNTGIEQNKASSSVMHASSASPGGSPSSGQQSASSSVLGPTKSRSKAKRIQLPLDKGS
GKKHKVSHMRTSSSEAHIPDPETNLASLTKVTGTPRSKSDVQDTANINQSSQKDFGQSTR
QVTAIPEELPTQNSTNEQESAEPKVTEEEESNFSSPLMFWLQQEQKRKESIGEKKPKKGL
VFEISSDDGFQICAESIEDAWKSLTDKVQEARSNARLKQLSFAGVNGLKMLGILHDAVVF
LVEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPP
EYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNI
DAGEMVIEYAGNVIRSIQTDKREKYYESKGIGCYMFRIDDSEVVDATMHGNAARFINHSC
EPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFLN
NT seq 11705 nt NT seq  +upstreamnt  +downstreamnt
ccgcttcatctgcgtcttcgtcgttgtcctcagcctcctcagggccggccctgctccggg
tgggcccgggcttcgacgcggcgctgcaggtctcggccgccatcggcaccaatctgcgcc
ggttccgggccgtgttcggggagagcggcgggggaggcggcagcggagaggatgagcagt
tcttaggttttggctcagatgaagaagtcaaagtgcgaagtcccacaaggtctccttcag
ttaaatctagtcctcgaaaacctcgtgggagacccagaagtatctctgaacgaaattcag
ctgtcctgtcagattcttcacctgtgttttcccctctaagcaaaccagagactaaatctg
gagaaaaaataaagaagaaagattctaaaagtggagaaaaaagaagaggaagacctccaa
cccttagcagtgtcaaattcaaattatcacaaggaaaggacatatcagacttatcaaagg
ggagcaaagaggataccttaaaaaaaattaaacggacaccttctgctacatttcagcaag
cagcaaaaataaaaaaattgagagctggcaaactctctccgctcaagtctaagtttaaaa
caggaaagcttcagattgggaggaaaggagtacagattgttcgacggagaggaaggcctc
catcatcagaacggataaagacagattcaacacccctcattaactctcagctggaaaagc
cccaaagagtccggaaagagaaagatggtacaccaccactcacaaaagaagaaaaggcag
ctgtcagacaaagccctcgaaggattaagcctgttaggattattccttccaccaaaagga
cagatgcaacaattgctaagcaacttttgcagagggcaaaaaagggagctcaaaagaaga
ttgaaaaagaagcagctcagctgcaaggaagaaaggtaaagacacaggtcaaaaacatcc
gacagttcatcatgcctgttgtcagtgctatctcctcacggatcattaaaacccctcggc
ggtttatcgaagatgaagattatgaccctccgattaaaattgctcgactagagtctacac
caaatagtaggttcagtgctacatcctgtggatcctctgaaaaatcaagtgcagcttcac
agcattcttctcaaatgtcttcagattcttctcgatctagcagtcccagtgttgatacat
ccacagattctcaggcctctgaggagatgcaggcactttctgaagagcggagcaatactc
cagatgtccatgctccattacctatttctcagtccccagaaaatgataacagtgatagga
ggagtagaagattttcaatatcggagagaagctttgggtctagagcttctaaaaaattat
cagctttgcaaagtgcccctcagcagccaacctcttcttctccacctccaccattactca
ctccgccacccccactacaaccagcttccagtattcctgaccatgcatcttggcttatgc
ctccaacaatccccttagcatcaccttttttgcctgcctctgctgcccccatacaagaga
aacgaaagtctattttacgagaaccaacgttcaggtggacctctctaaagcattctcgat
cagagccacagtacttttcctcagcgaagtatgccaaagaaggtcttatccgcaaaccaa
tatttgataactttcgaccccctccactgactcctgaggatgttggctttgcttctggtt
tttcaacatctggttccactgctccagcccagctattttcagcactccattctggaacta
ggtttgatatgcacaaaagaagtcctcttctaagagctcccagatttactccaagtgagg
cccactcccgaatctttgagtcagtaactttgcctagtaatcgaacatctgctggaactt
catctacaggggtatctaatagaaaaaggaaaagaagggtgttcagccctatcagatctg
aaccaagatctccttctcactccatgaagacaagaagtggaaggcttagtacttctgagc
tatcacctctcaccccaccatcttctgtctcttcttcattaagcatttctgttagtcctc
ttgccactagtgccttaaacccaacttttgcttttccttcccattccctgacacagtctg
gggaatcttcggagaaaaatcagagaccaaggaagcagactagcactccagcagagccat
tctcatccagtagtcctactcctctcttcccctggttcacacagagctctcagacagaaa
gagggagaaacaaagacagggccactgaggaactgtccaaagagcgagatgttgacaaga
gtatggagaaggacaaaaacagagagagagaccgggagagggaaaaagagaacaagcggg
aatcaaggaaagaaaagaggaaaaaggggtcagaaattcagagtagctctgctttgtttc
ccataggtagagtttccaaagagaaggttgttgaagatattgctacttcatcttccgcca
aaaaagctgcagggcggaagaaatcttcatcacttgatcctggttcagacattgccactg
tagctcttggggatacaacagctgtcaaaaccaaaatacttgttaagaaagggaaaggaa
gcctcgataaaaccaacttggaacttgcccctgctgcaccatcactggaggagaaagcac
gctgcctttctgcttcttcatcaagcactgttaaacattccacttcctccattggctcca
tgttggctcaggcagacaagcttccagtggctgacaagagagtagccagccttctgagaa
aggccaaagcccagctttataaaattgagaaaagcaagactctcaagcaagctgaccagc
ccaaagcacagggtcaagaaagtgattcatcagagacatctgttcgaggacccaggataa
aacatgtttgtagaagggctgctgttgcccttggccgaaagcgagcagtatttcctgatg
acatgcccaccctgagtgccttaccatgggaagaacgagaaaagattttgtcttccatgg
gaaatgacgacaagtcatcaatcgccggctcagaagatgctgaacctcttgctccaccca
tcaagccaattaagcctgtcacaagaaacaaggcacctcaagaacctccagtgaagaaag
gacgacggtcaaggagatgtgggcagtgtccaggctgtcaggtgcctgaggactgtggtg
tctgtactaattgcctagataagcccaaatttggtggccgcaacataaagaaacagtgct
gcaagatgaggaaatgccagaacctgcaatggatgccttccaaagcctatctgcagaagc
aagcgaaagctgtgaaaaagaaagagaagaagtccaagaccagtgaaaagaaagagagca
atattacaaaaaatcttgtggactctagtcagaaaacaactccaccagcaagagaggacc
atgccccaaagaaaagcagtgaacctcccccccgaaagcctgtggaagaaaagagtgagg
atggaaatgtgtctactgcagggactgattctaagcaatccagcacttctgctaggaaga
ctggcaaacaggtctcccagccagcgcaggtcattcctccacagccacctagcacagcac
cactaaaaaaggaagctcctaagaccactcttagtgagcccaagaaaaagcagcagccac
cacccccacccccaccacctcctccacctcctccaccacctccaccacctccagaatcag
taccagagcagagcaagccgaaaaaagtaactcctcgcccaagtattcctgtgaaacaga
aaccaaaagaaaaggaaaaaccacctccagtcagtaagcaagaaaatggcactctgaata
tactcaacactctttccaatggaaatagttccaagcaaaagttgccggcagatggagtcc
acaggatcagagtagactttaaggaagactgtgaagtagaaaatgtatgggagatgggtg
gtctaggcatcctgacatcagttcctataactcccagagtggtttgctttctctgtgcca
gcagtggacacgtggagtttgtgtattgccaagtctgttgtgagcccttccacaaattct
gtttggaggagaatgagcgccctctagaggatcagctggaaaattggtgttgtcgtcgct
gcaagttctgtcatgtgtgtggaagacaacaccaggctacaaagcagctgctggagtgta
ataagtgccgaaacagctatcaccctgagtgcctgggaccaaactacccaaccaaaccca
ccaagaaaaagaaagtttggatctgtaccaagtgtgttcgatgcaagagctgtggatcta
caactccaggcaaagggtgggatgcacagtggtctcatgatttttcactgtgccatgatt
gtgccaaactctttgctaaaggaaacttctgcccactttgtgacaaatgttatgatgatg
atgactatgagagcaagatgatgcagtgtgggaaatgtgatcgatgggttcactccaagt
gtgaaaacctttcagatgaaatgtatgaaattctctctaatctgcctgagagcgtggcct
atacctgtgtgaattgtacagtgcggcatcctgctgagtggagattggctttagaaaaag
agctccaaatttctttgaagcaggttttgacagcactgttaaattcgcgaaccaccagcc
acttactccgttacagacaggctgccaagccccctgacctaaatccagagactgaggaaa
gtataccttcccgaagctccccagaaggacctgatccaccaatcctgactgaggttagca
agcaagaagaacagcagcctttggacttggaaggcgtaaagaggaaaatggaccaaggag
gttatacctctgtgttggaattcagtgatgatattgtgaagattattcaagcagccatca
attcagatggagggcagccagaagttaaaaaagctaatagcatggtcaagtccttcttca
ttcggcaaatggaacgtgttttcccttggttcagtgtcaaaaagtccaggttttgggaac
caaataaagttaccagcaacagtggaatgttaccaaatgcagtgctaccaccttcacttg
accataattatgctcagtggcaagagagagaagagaacaaccacactgagcaacctcctt
tgatgaagaaaatcattccagctcctaaacccaaaggccctggagaaccagactcaccaa
ttcctctccatcctcctacaccaccaatcttaaatactgacaggagccgggaggacagtc
ctgagctgaacccacccccaggcgtagaagataatcgacagtgtgcattatgtttgacat
atggtgatgataatgctaatgatgctggccgcttactctacattggtcaaaatgagtgga
cccatgtgaactgtgctttgtggtcagcagaggtgttcgaagatgatgatgggtctctaa
agaatgtacatatggctgtgatcaggggcaagcaattgagatgtgagtactgccaaaagc
caggggccactgtaggttgttgcctcacatcctgcactagcaactatcacttcatgtgtt
cccgagccaagaattgtgtctttctggatgataaaaaagtttattgccaacgacatcgag
atttgatcaaaggagaggtggttcctgagaatggatttgaagtccttagaagagtttttg
tagactttgaaggtatcagcttgagaaggaagtttctcagtggcctagaaccagaaaata
tccacatgatgattggctcaatgacaattgactgtttaggaattctaaatgatctctctg
actgtgaagataagcttttccctattggatatcagtgttccagggtgtactggagcacca
cagatgctcgaaagcgctgtgtgtatacgtgcaagatagtggaatgtcgtcctccaattg
tagagccagatatcaacagtactgttgaacatgatgagaataggaccattgctcatagtc
ctacctctcttacagaaattccaccaagagagattcgcaatacagctgaaattataagtc
ctccatccccagatcgacctcttcattcacatacctccagcccctgtttctatcatgtca
tctcaaaagtccccagactccgaatgcccagctattctccaacacagagatcccctggtt
gtcgtccattgccttctgctgggagtcctaccccaactacccatgagatagttacagtgg
gagaccctttactctcttctgggcttcgaagcattggatccagacgtcatagcacttctt
ctttatcacctcagcggtccaaattccggataatgtccccaatgagagctgggaatgctt
attcccgtcacagtgtctcctctatctctggcattggtgcccccgctgatcatgattcaa
atgtaaaaacaattgaccacttcctagggtcattgaatccaagcaccccaaatattttgg
gtcaaaacactccagcttcttcaagttctcaaaggacattggttacagttggaactaaag
caggtcatatggatggatctccatcttcagagatgaaacatattagtgctgcagacttgt
caactaaaagctcctccttgaaaggagacaaaggcaaaatgttgaattccaaggggtcag
aggcatcaacacatgtattgacttatcctgggcatcttaaaccagccacccaggttcata
atacaacatctggagaggtaaatgttagtaaagtgggtgcttttgttgaaccttcttcag
tatcattttcttctaaagaggtcctttcctttcctccactccatctgaggggacaaaaaa
aggagagagaccaacatacaaactctacccagccagaaaacctttctccaggtgaagaca
tagaaactaaagcattgaaggcacctggggtaaacagatcatctattgcaaatgaacaag
tgatgtctggttttagagacagaagacagaaaggaaagaaatctggtaaagaaactttca
aagagaagcattcaagtaagtcttttctggatcccgttacagtaatggctggtgaagaag
gaaacttaaagccagaatttgtcaaccaggttttgacatctgagcatataagccaacgat
cttgtaataatatttcttctgagaagagtggggataagatccttcctatttcaggaggtt
ccaaagtgccatctgtgcagttggaaggaccagccaaggaatcacaaacccctcggaaac
gcacagtcaaagtaaccttgacaccactgaaaatggaaaatgagagtccatctaaaaaca
cattgaaagaagttgttcctgtttctccatcccaaggaatagaatcagcaactttggcag
aatcatcctcaactttagaaagcccaggagatggctctgtaacacaacccagccccaatg
atactgcatcccaagaatctcagagtaacacctatccgaatcttgctgtccaggatagaa
acttgatgctacaagatggcaccaagactcaggaagatagttcatacaagaggagatatc
ctcgccgcagtgcccgagcccgctctaatatgttttttgggcttactcctctctatggag
taagatcctatggggaggaagatattccattctttagcagttcttcaggaaagaaacgag
gaaagaggtctgctgaaggacaggtggatggggctgatgacttaagcacttcagatgaag
atgatttatactactacaattttaccaggacagtgatttcttcaagtggggaagaacgat
taggatcccataatttatttagggaagaagagcaatgtgacatcccaaagatttcacagc
tagatggtgtagatgatgggacagagagtgatactagtgtcacaactacaacaaggaaag
tcagtcaactttccaaaagaaatgcaaaagaaaatgggacagagaactccttaaagcttg
atcgagctgaggattctggggaaaaggaacatgtcatcaagagttcagcgggtcacaaaa
ctaatgaacctaaaatagacaattgccatcctgtaagcagagtgaaaacacaaggacaag
attccctggaggcccagctcagctcactggagtctggccgtagagtccacacaagtaccc
cttcagataaaaatctgctagattcttataacacagagcttctgaaatctgattctgaca
acaataatagtgatgattgcgggaacatcttaccctcagatattatggactttgtgttaa
agaatactccctccatgcaagcgttaggagagagtccagagtcatcttcatctgaactct
tgactcttggggaagggttgggtcttgacagcaaccgtggaaaagatatgggtctctttg
aagtgttttctcaacagttaccaacagcagaacctgtggacagtagtgtgtcttcctcta
tatcagcagaggagcagtttgagttgcctttggagctcccatcagatctatctgtcctaa
ctacccggagccccactgtgcccagccagaacccaaacagaatggcagtaatctcagata
ctggagagaagagagtgacaatcacagaaaaatctgtggcttcaactgaaagtgactcat
cactgttgagcccaggagtagatccaaccccagaaggtcacatgaccccagatcatttca
tccaaggacatatggatacagaccatattgctagccctccctgtggttcagtagaacaag
gacatggaaacaaccaggacttaactagaaacagcagcactcctagtcttcaggttcctg
tttctcctactgttccacttcagaatcaaaaatatgttcccagttctacagacagccctg
gtccatctcagatttcaaatgcagctgtccagaccactccacctcacatgaaaccagcca
ctgagaaacttcttgttgtcaaccagaatatgcaaccactatatgttctccagacccttc
caaatggagtgactcaaaaaatacaactaaccccttcagtaagttctgcccccagtgtga
tggaatccaatacttcagtgcttgggcccatgggcagtggtctcgctttagccactggac
tgaatccaagtttgccagcatctcagtctttgttccccccttctagcaaaggattgctcc
ccatgactcatcaccagcacttacattcttttcctgcagctactcaaagtagtttcccac
ccaacatgaataatcctacttcaagcctgttaattggtgtccaacctcctccagatcccc
aacttttggtttcagaaactaatcagaggacagaccttaataccactgcaaccactccac
ctcctgggctaaagaaaaggcccatatctcgcctacactcacgaaagaataaaaaacttg
ctccttcaagcacttcgtcctctattgccccctctgatatggtctctaacatgactctga
ttaattttacaccttcccagctttcaaatcacccaagtctattagatttaggatcacttg
gaaataccacctcccaccgaacagtccccaacatcatcaaaaggtctaagtctggaatta
tgtactttgaacaggcacccttgttgccacagagtgtgggaagagctgctgcttctacag
ttgggacatcaacaataggcccagattccagtcacctcacagcaggacctgtttctggtt
tggcatcaggttcctctgtccttaatgttgtttccatgcaggctacaacagcccctacca
ctggtggatcagttccaggacatgttttgggccagggctcagtcacattaaccagcccaa
ggttgcttggtgccccagacattggctcaataagcaatctcttaatcaaagccagccaac
agagcctggggcttcaggagcagcccatgacattgccaccaggatcaggaatgtttcccc
agctggaaacatcacaacccccctccactgctgcaatgacatctgcatccagtatttgtg
tgcttccttccacccagactgtgggcatgacagttgccccttcatctaatgaaccagaag
gatcctatcagcttcagcacatgacccaactccttgccagcaaaactgggattctcccct
cccagttagatgttgcttcaacttcaggaagccaattgtcaagttttccccagctggttg
atgttcccaacaacacaggaatagagcagaacaaggcttcatcctcagtaatgcatgcta
gctcagcctctcctgggggttccccatcttctggtcaacaatcagcaagcagttcagtgc
taggtcccaccaagtccaggtcaaaagccaaacggattcagctgcctttagacaagggga
gtggtaagaagcacaaggtttcccacatgcggaccagttcctctgaagcacacattccag
atccagaaaccaaccttgcatccctgaccaaagtgacagggactccacgatcaaaatcag
atgttcaggatacagctaacatcaatcaatcatcacaaaaggattttggacagtctacac
ggcaagtaactgcaattccagaagaattgccaacacagaattcaacaaatgagcaagaaa
gtgcagaacctaaggtgactgaagaagaggaaagcaacttcagttctccactaatgtttt
ggttacagcaagaacagaaaaggaaggaaagcattggagaaaaaaagccaaagaaagggc
ttgtttttgaaatatcgagtgatgatggttttcagatttgtgcagaaagtattgaagatg
catggaaatcattgacagataaagttcaggaagccagatccaatgctcgtctaaaacagc
tttcatttgcaggtgtgaatggcttgaagatgctagggattcttcatgatgcagttgtat
tcctagttgagcagctttctggggccaaacattgtcggaattataagtttcgattccaca
aaccagaggaagccaatgaacccccactgaatcctcatggttcagccagagctgaagtcc
acctgaggaagtcagcatttgacatgtttaacttcctggcttctaaacatcgacagcctc
ctgaatataatcccaatgatgaggaagaagaagaagtacagctgaaatcagctagaaggg
cgactagcatggatttgcccatgcccatgcgtttccggcacttaaagaagacttcgaagg
aagcagttggggtctacaggtctcccatccacggtcgaggtctattctgtaagagaaaca
tcgacgcaggtgagatggtgattgaatatgcaggcaacgtcatccgttccatacagactg
acaagcgagagaagtattatgagagcaagggcattggctgctacatgttccgcatcgatg
actcggaggtagtggacgccaccatgcatgggaatgctgcacgatttatcaaccattcat
gcgagcccaactgctattctcgggtcatcaacatcgatgggcagaaacacatcgtcatct
ttgcgatgcggaagatctaccgtggagaagaactcacttatgactataagttccccattg
aggatgccagcaataagctgccctgcaactgtggcgctaagaaatgccgaaagttcttaa
actaa

DBGET integrated database retrieval system