KEGG   Sarcophilus harrisii (Tasmanian devil): 100924614Help
Entry
100924614         CDS       T02286                                 

Gene name
UGP2
Definition
UDP-glucose pyrophosphorylase 2
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:shr00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:shr00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:shr00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:shr00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 521 aa AA seqDB search
MASFSAADVGGFGEEAGAGDLSKAMSQGGTSQFQEVIRQELELSVKKELEKILSTAPLNE
SEHTKKDLEGFQKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNK
LVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNT
DEDTKKILQKYSHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIY
ASFYNSGLLDTLIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTR
ADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEENA
IDMEIIVNPKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSN
LYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFG
KNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcctccttctccgcagccgatgtcgggggcttcggcgaagaggcgggagcaggcgat
cttagcaaagcaatgtctcaaggtggtacttcccaattccaagaagtcatccgacaagag
ctggaattatcagtgaagaaggaattagagaaaatactttcaacagccccactaaatgaa
tctgagcatactaaaaaagatcttgaaggatttcagaagttattccatagattcttacaa
gaaaaaggaccttctgtggattgggggaaaatccagaggcctccagaggactcgattcag
ccttatgaaaagataaaggccagaggcttgccagataatatatcttccgtcctgaataag
ttggtggtagtaaaactcaatggtggcttgggaacaagcatgggctgtaaaggccccaaa
agtctaattggggtacggaatgaaaacacctttttggatttgacagttcagcaaattgag
cacttgaacaaaacttacaacacagatgttcctcttgttttgatgaactcttttaatact
gatgaagatacaaagaaaatacttcagaaatacagtcattgccgtgtgaaaatctacact
tttaatcaaagcaggtaccctagaattaataaagaatctttactgcctgtagcaaaggat
gtctcatactcaggggaaaatacagaagcttggtatcctccaggtcatggagacatttat
gccagtttctacaattctggtttgcttgatactcttataggagagggaaaggagtacatt
tttgtgtcgaacatagacaatttgggtgccacagtggatctgtatattcttaaccatctt
atgaatccacccaatggaaaacgttgtgaatttgttatggaagtcacaaacaagacaagg
gcagatgtaaagggtggtacccttacacaatatgaaggcaaactgagattggtagaaatt
gctcaagtgccaaaagcccacgttgatgaattcaagtctgtatcaaaattcaaaatattt
aacacaaacaatctgtggatctctctagcagcagtcaagagactgcaggaggagaatgcc
attgatatggaaatcattgtcaatccaaagaccttggatggaggcctaaacgttattcag
ttggagactgcggttggagctgctataaaaagttttgagaattctcttggcattaatgtt
cctcgaagccgttttctgcctgttaaaactacatctgatcttctacttgtaatgtcaaat
ctctacagtcttaatgcaggatccttaacaatgagtgaaaagcgagaatttcctactgtg
cccttggttaaattaggaagctcttttacaaaggtccaggattacctaaggaggtttgaa
agtataccagatatgctcgaattggatcatctcacagtgtctggagatgtgacatttggc
aagaacgtctcattaaagggaacggttatcatcattgcaaaccatggtgacagaattgat
atccctcctggagctgtgttagagaataaaattgtatctggtaaccttcggatcttggac
cactga

DBGET integrated database retrieval system