KEGG   Sarcophilus harrisii (Tasmanian devil): 100924614Help
Entry
100924614         CDS       T02286                                 

Gene name
UGP2
Definition
UDP-glucose pyrophosphorylase 2
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100924614 (UGP2)
   00052 Galactose metabolism
    100924614 (UGP2)
   00500 Starch and sucrose metabolism
    100924614 (UGP2)
   00520 Amino sugar and nucleotide sugar metabolism
    100924614 (UGP2)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     100924614 (UGP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 521 aa AA seqDB search
MASFSAADVGGFGEEAGAGDLSKAMSQGGTSQFQEVIRQELELSVKKELEKILSTAPLNE
SEHTKKDLEGFQKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNK
LVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNT
DEDTKKILQKYSHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIY
ASFYNSGLLDTLIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTR
ADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEENA
IDMEIIVNPKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSN
LYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFG
KNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcctccttctccgcagccgatgtcgggggcttcggcgaagaggcgggagcaggcgat
cttagcaaagcaatgtctcaaggtggtacttcccaattccaagaagtcatccgacaagag
ctggaattatcagtgaagaaggaattagagaaaatactttcaacagccccactaaatgaa
tctgagcatactaaaaaagatcttgaaggatttcagaagttattccatagattcttacaa
gaaaaaggaccttctgtggattgggggaaaatccagaggcctccagaggactcgattcag
ccttatgaaaagataaaggccagaggcttgccagataatatatcttccgtcctgaataag
ttggtggtagtaaaactcaatggtggcttgggaacaagcatgggctgtaaaggccccaaa
agtctaattggggtacggaatgaaaacacctttttggatttgacagttcagcaaattgag
cacttgaacaaaacttacaacacagatgttcctcttgttttgatgaactcttttaatact
gatgaagatacaaagaaaatacttcagaaatacagtcattgccgtgtgaaaatctacact
tttaatcaaagcaggtaccctagaattaataaagaatctttactgcctgtagcaaaggat
gtctcatactcaggggaaaatacagaagcttggtatcctccaggtcatggagacatttat
gccagtttctacaattctggtttgcttgatactcttataggagagggaaaggagtacatt
tttgtgtcgaacatagacaatttgggtgccacagtggatctgtatattcttaaccatctt
atgaatccacccaatggaaaacgttgtgaatttgttatggaagtcacaaacaagacaagg
gcagatgtaaagggtggtacccttacacaatatgaaggcaaactgagattggtagaaatt
gctcaagtgccaaaagcccacgttgatgaattcaagtctgtatcaaaattcaaaatattt
aacacaaacaatctgtggatctctctagcagcagtcaagagactgcaggaggagaatgcc
attgatatggaaatcattgtcaatccaaagaccttggatggaggcctaaacgttattcag
ttggagactgcggttggagctgctataaaaagttttgagaattctcttggcattaatgtt
cctcgaagccgttttctgcctgttaaaactacatctgatcttctacttgtaatgtcaaat
ctctacagtcttaatgcaggatccttaacaatgagtgaaaagcgagaatttcctactgtg
cccttggttaaattaggaagctcttttacaaaggtccaggattacctaaggaggtttgaa
agtataccagatatgctcgaattggatcatctcacagtgtctggagatgtgacatttggc
aagaacgtctcattaaagggaacggttatcatcattgcaaaccatggtgacagaattgat
atccctcctggagctgtgttagagaataaaattgtatctggtaaccttcggatcttggac
cactga

DBGET integrated database retrieval system