KEGG   Sarcophilus harrisii (Tasmanian devil): 100924653Help
Entry
100924653         CDS       T02286                                 

Gene name
PFN2
Definition
profilin 2
Orthology
K05759  
profilin
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100924653 (PFN2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100924653 (PFN2)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100924653 (PFN2)
Exosome [BR:shr04147]
 Exosomal proteins
  Proteins found in most exosomes
   100924653 (PFN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 215 aa AA seqDB search
MTRRGWLVLLCQNRSHLDSLTSLKCIFFRSSRTNNMKAQERRDPTKGTQEDPLGVKDSWE
PRQVMVVVFIPGQAFTDEDQWEPPKVGVFGEGQPQGASVXXXXXXXWAATAGGIFQSITP
IEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGR
AGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgacaagacgaggttggctggtgttactttgccagaaccggagtcacctggattctctt
acctccctaaagtgcattttcttccgttcctcccgcactaacaatatgaaagcccaagag
cgacgggaccccacaaaagggactcaggaggatcccctcggcgttaaggattcatgggag
ccgaggcaggtgatggtggttgtttttattcctggacaagcctttacggacgaagaccag
tgggagccccccaaggtgggcgtgttcggggaagggcagccccagggggcttccgtnnnn
nnnnnnnnnnnnnnnnngtgggcggccaccgccggaggcatcttccagagcatcacgcca
atagaaatagacatgattgtaggaaaagatcgagagggtttctttaccaatggtttgact
cttggtgcaaagaagtgctcagtaatcagagatagtctgtatgtggatggtgactgcaca
atggacatcaggacaaagagtcaaggtggtgaaccaacatataatgttgctgtaggcaga
gctggccgagtcttggtctttgtaatgggcaaagaaggggtccatggaggtggattgaat
aagaaggcatactcaatggccaaatacttgagagactctgggttctag

  All links  
No link information was found.   
DBGET integrated database retrieval system