KEGG   Sarcophilus harrisii (Tasmanian devil): 100924653Help
Entry
100924653         CDS       T02286                                 

Gene name
PFN2
Definition
(RefSeq) profilin-2 isoform X1
  KO
K05759  profilin
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04015  Rap1 signaling pathway
shr04810  Regulation of actin cytoskeleton
shr05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100924653 (PFN2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100924653 (PFN2)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100924653 (PFN2)
Membrane trafficking [BR:shr04131]
 Others
  Actin-binding proteins
   Others
    100924653 (PFN2)
Cytoskeleton proteins [BR:shr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     100924653 (PFN2)
Exosome [BR:shr04147]
 Exosomal proteins
  Proteins found in most exosomes
   100924653 (PFN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Profilin
Motif
Other DBs
NCBI-GeneID: 100924653
NCBI-ProteinID: XP_023356509
Position
3
AA seq 140 aa AA seqDB search
MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGIFQSITPIEIDMIVGKDREGFF
TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVH
GGTLNKKAFELALYLRRSDV
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggctggctggcagagctacgtggacaacctgatgtgcgatggctgctgccaggaggcc
gccattgtcggctactgcgacgccaagtacgtgtgggcggccaccgccggaggcatcttc
cagagcatcacgccaatagaaatagacatgattgtaggaaaagatcgagagggtttcttt
accaatggtttgactcttggtgcaaagaagtgctcagtaatcagagatagtctgtatgtg
gatggtgactgcacaatggacatcaggacaaagagtcaaggtggtgaaccaacatataat
gttgctgtaggcagagctggccgagcattggttatagtcatgggaaaggaaggtgtccat
ggagggacactgaacaagaaagcatttgaactcgctttatacctgaggaggtctgacgtc
taa

DBGET integrated database retrieval system