KEGG   Sarcophilus harrisii (Tasmanian devil): 100924660Help
Entry
100924660         CDS       T02286                                 

Definition
acyl-protein thioesterase 2-like
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:shr00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 74 aa AA seqDB search
AANGMARATAIWQCHGELDPMVPVRFGALTSEKLKLVVPPSKVQFKTYPGVMHSSCPQEM
AAVKEFIEKLLPPI
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
gctgccaatggcatggcccgggccacagccatctggcagtgccatggggagctggacccg
atggtgccagtgcgctttggagccctcacgtcggagaagctcaagttggtggtccctcca
tccaaggtccagtttaagacctacccgggcgtcatgcacagctcctgcccccaggagatg
gcagctgtgaaggaattcatcgagaagctgttgccccccatctaa

DBGET integrated database retrieval system