KEGG   Sarcophilus harrisii (Tasmanian devil): 100924660Help
Entry
100924660         CDS       T02286                                 

Gene name
LYPLA2
Definition
(RefSeq) acyl-protein thioesterase 2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
3
AA seq 231 aa AA seqDB search
MCGNTMSVPLLSDAATVSGAERETAAVIFLHGLGDSGHSWADALSSIRLPYVKYICPHAP
RIPVTLNMKMVMPSWFDLMGLSPDAPEDEVGIKKAAENIKALIEHEVKNGIPANRIILGG
FSQGGALSLYTALTCSFPLAGIVALSCWLPLHRAFPQAANGMARDLAILQCHGELDPMVP
VRFGALTSEKLKLVVPPSKVQFKTYPGVMHSSCPQEMAAVKEFIEKLLPPI
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtaacactatgtctgtccccctgctctccgacgccgcgactgtttcaggagct
gagcgggagacagcagcggtaatttttttacatggacttggagactcagggcacagctgg
gctgatgccctctcctccatccgcctcccttatgtcaagtacatctgtccccacgcgcct
cgcatcccagtcacgctgaacatgaaaatggtgatgccttcctggttcgacctgatgggc
ctgagccccgatgccccggaggatgaagttgggatcaagaaagcggcagagaacatcaag
gccctgattgagcatgaggtgaagaatgggattccagccaatcgaatcatcttggggggc
ttctcgcagggaggagccctgtccctctacacagctctcacctgctcgtttcccctggcc
ggcatcgtggccctcagctgctggctccctctgcatcgggccttcccccaggctgccaat
ggcatggcccgggacctggccatcttgcagtgccatggggagctggacccgatggtgcca
gtgcgctttggagccctcacgtcggagaagctcaagttggtggtccctccatccaaggtc
cagtttaagacctacccgggcgtcatgcacagctcctgcccccaggagatggcagctgtg
aaggaattcatcgagaagctgttgccccccatctaa

DBGET integrated database retrieval system