KEGG   Sarcophilus harrisii (Tasmanian devil): 100924872Help
Entry
100924872         CDS       T02286                                 

Gene name
NCOA1
Definition
(RefSeq) nuclear receptor coactivator 1
  KO
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Estrogen signaling pathway
Thyroid hormone signaling pathway
Pathways in cancer
Breast cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    100924872 (NCOA1)
   04919 Thyroid hormone signaling pathway
    100924872 (NCOA1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100924872 (NCOA1)
   05224 Breast cancer
    100924872 (NCOA1)
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100924872 (NCOA1)
Chromosome [BR:shr03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100924872 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
1
AA seq 1443 aa AA seqDB search
MSGLGDSSTDPSNPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANIGDIDSL
SVKPDKCKILKKTVDQIQQMKRMEQEKTATDDDVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNREGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIRPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEEGEDFQ
SCLICIARRLPRPAAITGSESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTAFSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSVLSPQDNTNSGMSLPRINPSVNPSISPAQGMARSSTLPPSNNNLVTPRVNH
QPSSDLHSSSSNSNSNTNQGSFGCSSGNQVVASVALNQGQAGSQGSNHSLSLNNSPMDST
GITLAQFMSPRRQVSSGLATRPRMPSNSFSPNIPSLSSPIGMVGSACGNPNRTYSNIPAT
SLQGINEGPSNSIGFSATSPVLRQLSSQNSPSRMNMLPTKAESKDSKEITSILNEMVQSD
NSSNDVKPLDSGLLHNSDKLSEGENKYSQTSHKLVQLLATTAEQQLRHTDADTSGKDALS
CSGTSTSTANNSSSSGNTCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEHDKKDNGSS
SVSNQVPGNSNIKLELEASKKKESKDHQLLRYLLDKDEKDLRAAPTLSLDDVKVKVEKKE
QMDPCNTTPTPLTKPAPEEIKLESQNQFPADLEQFDPLLPTLEKASQLPSLCESERIEAG
GTGVTVKSEILPTALQSTPARPPPRLNRLPELELGGLDHQFGQPGIDDQVPWANNTLTAM
NQGPLNKSEDQCITSQLDELLCPPTTIEGRNDEKALLDQLVSFLSGTDETELAELDRALG
IDKLVQGGGLEVLTERFQPQQSTPPLMMEERSSLYSQPYSSASPTANLPGPFQGMIRQKP
SMGTMPVQVPPPRGAFPTNMSMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAI
LNQFAASAPVGINMRSGIQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRALLMR
QQSFGNNLPPSSGLPVQMGTTRLPQGAPQQFPYPSSYGTNPGTPPASTSPFSQLTSNPEA
SLASRNNMVNRGMTGNVGGQFGTGINPQMQQSVFQYPGSGLGQQGEPNFTPSLSPGSPMM
SLQIPPSQSPMLQQAQPSSGYQSPDMKTWQQGAIGNNNMFSQNQPTPAQPGVYNNMSITV
SMAGGNTNVQNMNPLMGQMQMSSLQMPGMNTVCSEQINDPALRHTGLYCNQLSSADILKT
ESDGSAQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGSQKPTSGPQNPQAQQKSLLQQL
LTE
NT seq 4332 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcctcggagacagctcgacagacccttctaacccagattcacacaagagaaaa
ggatcaccatgtgacacactggcatcaagcaccgaaaagaggcgtagggaacaagaaaac
aagtatttagaagagctggctgaattactatctgctaacattggtgacattgacagtctg
agtgtaaaaccagacaaatgcaagatcttaaagaaaacagtcgatcagattcagcaaatg
aaaagaatggaacaagagaaaacagcaacagatgatgacgtccagaaatcagacatctca
tcaagtagtcaaggagtaattgaaaaggaatctttaggaccacttctcttggaggccttg
gatggatttttctttgttgtgaatcgtgaaggaagaattgtatttgtgtcagaaaatgtg
actagctacttgggttacaatcaggaagaactgatgaataccagtgtctacagcatatta
catgtgggagatcatgcagaatttgtcaagaatctgctaccaaaatcactagtaaatgga
gttccatggcctcaggaagcaacaagacgaaatagccatacttttaactgccggatgcta
attcgccctccagatgaaccaggtacagaaaatcaagaagcttgccagcggtatgaagta
atgcagtgtttcactgtgtcacagcctaaatcaatccaggaagaaggagaagatttccag
tcatgtttgatttgtattgcacggcgtttacctcgtcctgcagctattacgggttcagaa
tcatttatgaccaagcaagatactacaggtaaaatcatctctattgacaccagttccttg
agagctgctggtagaactggctgggaagatttagtgaggaaatgcatttacgcctttttt
cagcctcaaggcagagagccatcttatgccaggcagctatttcaagaagtgatgactcgt
ggcactgccttcagcccatcctataggttcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgtaaactttgctaccctcaaagtccagatatgcagcctttcatcatggga
attcatatcatcgacagggaacacagtgttctttctcctcaagataacactaattctgga
atgtcacttcctcgaataaacccatcagtaaatcctagtatctctccagcccagggcatg
gccagatcatccacacttccaccttctaacaacaacctggtgactcctagagtaaaccac
caaccaagctctgaccttcatagcagcagcagtaatagtaattccaacaccaaccaaggg
agctttggctgttcatctggaaatcaagttgtagccagtgttgccttaaaccagggacaa
gctggttcccagggcagtaatcactctttaagcctcaacaattcaccaatggatagtaca
ggaattaccttagcacagtttatgtctccaagaagacaggttagttctggattagcaaca
aggccgagaatgccaagcaattctttttctcccaatattccttcattgagttcccccatt
ggtatggtaggtagtgcctgtggtaatcctaataggacttattcaaacatcccagcaact
tctttacagggtattaatgaaggacccagtaattccatcggcttttctgctacttctcct
gttctcagacagctgagttcacaaaattctcctagcagaatgaatatgctcccaacaaaa
gcagaatccaaagacagcaaagagatcacttctattttaaatgaaatggtccaatcagac
aacagttcaaatgatgttaaaccactggattcaggcctcttgcataatagtgacaaactt
tcagagggagaaaataaatactctcaaaccagtcataaactagtgcagcttctagcaaca
actgctgaacagcagctacgacacactgatgctgatacaagtggcaaagatgcgttatct
tgttcaggcacttcaacttcaacagctaataactcttcatcttcaggcaacacttgccct
tcctctcatagttcattgactgagagacacaaaattctacacaggctcttgcaagaaggt
agtccttcagatataactactctgtcagtggagcatgacaaaaaggataatggttctagc
tctgtgagtaatcaagtgccagggaactccaacataaaattagagctagaggcttcaaag
aaaaaggaatcaaaggaccaccaactgttgcggtaccttttagataaagatgagaaagac
ttacgagcagctccaaccttgagtttggatgatgtgaaagtgaaagttgaaaagaaagag
cagatggatccttgtaacacaaccccaacgccacttactaaacctgcaccggaggaaatc
aagttagagtcccaaaatcagtttccagctgatcttgaacagtttgatccattactgcca
acactggagaaagcatcacagctgccaagtttatgcgagtcagaaaggattgaagctgga
ggcactggggtaaccgtcaaatcagaaatcctgccaactgcccttcagtctaccccagca
agaccacctccccgactgaatagattgcctgaacttgaattgggtggtctagatcatcag
tttggtcagccaggaatagatgaccaagttccatgggcaaataacacattaactgctatg
aatcaaggacctctgaataaatcagaagaccagtgcattacctcccagctagatgagctt
ctatgcccacctacaacaatagagggaagaaatgatgagaaggcccttcttgatcaactg
gtatcctttctcagtggcacagatgaaactgaattggctgaactagaccgagcccttgga
attgacaaacttgtccagggaggtggattggaagtattgacagaaagatttcaaccgcaa
caatcaacaccacctttaatgatggaggaaaggtctagcctatattcgcagccttactct
tcagcttcacctactgcaaatctccctggtcctttccaaggcatgattaggcaaaaacct
tccatgggaaccatgccagttcaagtaccaccacctcgaggagcttttcctactaatatg
agcatgcagcctcgccagactctgaacaggcctccagctgctcccaaccaacttagactt
caactgcaacaaaggttgcagggacagcagcagttgatacaccaaaatcggcaggctatc
ttaaaccagtttgcagcatctgcccccgttggcattaatatgaggtcaggcattcaacaa
cagatcacaccacagcctcctttgaatgcccagatgttggcacagcgacagcgagaattg
tacagtcaacaacaccggcaaaggcagctaatacaacagcagagagctctattaatgaga
caacaaagttttgggaacaacctccctccttcatctggactcccagttcaaatgggaact
actcgtcttcctcagggtgctccacagcaattcccttacccttctagttatggtacaaat
ccaggaactcctccagcctccaccagtccattttcacaactgacatcaaatcctgaggca
tccttggccagccgcaacaatatggtcaacagaggtatgacagggaatgttggaggacag
tttggtactggaatcaatcctcagatgcagcagagtgtcttccagtatccaggatcagga
ttaggccaacaaggtgaacccaattttactccatctctcagtcctggcagtcccatgatg
tcactgcagattcctccatctcaaagccctatgctgcagcaagctcagccctcttcaggc
taccaatcaccagacatgaagacctggcagcaaggagcaattggcaataacaacatgttc
agtcagaaccagcctacacctgcacagccaggagtatacaacaatatgagcatcaccgta
tccatggcaggaggaaacacaaatgtccagaatatgaaccctctgatgggccagatgcag
atgagttcactgcagatgccgggaatgaatacagtgtgttctgagcagataaatgatcca
gcactgagacacacaggcctttactgcaatcagctttcatcagctgacattctcaaaaca
gaatcagacggcagtgcccagcaggtgcagcaggttcaggtgttcgccgatgtccagtgt
acagtgaatctggtaggcggggacccttacctgaaccaacctgggcccctgggatctcaa
aaacccacatcaggtccgcagaacccccaggcccagcagaagagcctccttcagcagcta
ctgactgaataa

DBGET integrated database retrieval system