KEGG   Sarcophilus harrisii (Tasmanian devil): 100924992Help
Entry
100924992         CDS       T02286                                 

Definition
acyl-protein thioesterase 1-like
Orthology
K06128  
lysophospholipase I [EC:3.1.1.5]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100924992
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100924992
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 200 aa AA seqDB search
MKFRHGWAEAFAGIRSSHIKYICPHAPVMPVTLNMNMAMPSWFDIIGLSPDSQEDEQGIK
QAAENIKALIDQEVKNGIPSHRIVLGGFSQGGALSLYTALTTQQKLAGVIALSCWLPLRS
SFSQGPINGVNKDISILQCHGDCDPLVPHMFGSLTVEKLKTLVNPSNVSFRTYEGMMHSS
CNQEMLDVKQFVDRLLPPVD
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttaggcatggatgggcagaagcttttgcaggtatcagaagttcacatattaaa
tatatttgtccacatgcaccagttatgcctgttaccctaaatatgaacatggctatgcct
tcttggtttgatattattggtctttctcctgactcacaggaggatgagcagggaataaaa
caagctgcagaaaatattaaggctttaatagatcaagaagtgaagaatggaattccatct
cataggattgttttgggagggttttctcagggaggagctttgtctttgtatactgctctt
acaacacagcaaaaattggctggtgttatagctctcagctgttggcttccacttcgatct
tcattttcacagggtcctataaatggggttaataaagatatttctattctccagtgtcat
ggagactgtgaccctttggttcctcatatgtttggttctctcactgttgaaaagctaaaa
acactggtaaatccttctaatgtaagcttccgtacctatgaaggcatgatgcacagttca
tgtaatcaggaaatgttggatgtcaagcaattcgttgatagactcctacctccagttgac
tga

DBGET integrated database retrieval system