KEGG   Sarcophilus harrisii (Tasmanian devil): 100925655Help
Entry
100925655         CDS       T02286                                 

Gene name
DBH
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    100925655 (DBH)
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     100925655 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 632 aa AA seqDB search
MTTESQSLCTRSMQAPSSHHRRAWCPSFKLREVASMYCTMVAIFFIILVAALQGTAPSEN
HFPYKVPLDPEGILELSWNISYTEEVICFQLLIKELKYGVIFGMSDRGEFDNADLVVLWS
DGKNSYFGDAWTDAKGQIHLDSQQDYQLLKAQKTFGGLLLLFKRPISTHDPKDYLIEDDT
VHLVYGFLDEPFPSLEAINTSAIQKGLQRVQLLKPNISKPTLPPDLEDMEITAPDIIIPN
QETTYWCYIKELPDHFSRHHIVMYEPIITKGNEALVHHMEVFQCAAEIEKVPHFNGTCDS
KMKPEKLNHCRHVLAAWALGAKPFYYPEEAGLPFGGPGSSKYLRLEVHYHNPLELKGVHD
SSGLRLYYTSMLRPFDAGIMELGLVYTPVMAIPPKETDFILTGYCTDKCTKLALPQSGIH
IFASQLHTHLTGRKVITVLAREGRVTEIVNRDNHYSPHFQEIRKLKKIVTVLPGDVLITS
CTYNTEDRKLATVGGFSITEEMCVNYIHYYPQTQLELCKSAVDPGYLQKYFHLINSFNNE
DNGNYSNSSVKEQFASVSWNSFSRDVLKSLYDFAPISMHCNKSSAIRFPGEWERQPLPKI
KMGLKEVTPQCQTIPGLSPASPALVNIDGKKG
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgagagtcagagtttgtgcaccagaagcatgcaagcccccagcagccaccac
agaagagcgtggtgtcccagcttcaaactgcgagaggtggcatccatgtactgcaccatg
gtagccatcttcttcatcatcctggtagcagctttgcagggtacagctccctcagaaaac
catttcccttacaaggtccccctggaccctgagggcatcctggagttgtcctggaacatc
agctatacagaggaggtgatttgcttccaacttctaatcaaggagctaaaatatggggtg
atttttgggatgtctgaccggggtgaatttgacaatgctgatctagttgtgctctggagt
gatggaaaaaattcctattttggggatgcatggactgatgcaaaggggcagatccatctt
gattcccaacaggattaccagcttttgaaagctcagaagacttttggaggactcttgctt
ctttttaagaggcccatcagcacccatgaccctaaagattatctcattgaggatgacacc
gtacacttggtgtatgggtttcttgatgagccattcccctcgctggaagccatcaacaca
tctgccattcagaaggggcttcaacgagtacagcttctgaagcctaacatctctaaacct
acattgcctcctgatctggaagatatggaaataacagccccagatatcattattcccaac
caagaaacaacatactggtgctacataaaggagctcccggatcacttttctcggcatcat
attgtcatgtatgagcccatcattaccaagggcaatgaagccctggtccaccacatggaa
gtcttccagtgtgctgcggaaattgagaaggttccacacttcaatgggacctgtgattca
aagatgaaacctgaaaagctgaaccactgcagacatgttttggctgcctgggccttagga
gccaagccattttattacccagaggaagctggtcttccttttggaggtccaggatcttca
aaatatcttcgcctagaggttcactatcacaaccctcttgagttaaaaggtgtccatgac
tcctcaggcctccgcttgtattatacatctatgctaaggccatttgatgctggcatcatg
gagctgggccttgtgtacactcctgtgatggctatcccacccaaagagactgacttcatc
ttgactggctattgcactgataaatgcaccaaattggctctgccacagtcagggatccac
atctttgcttcccaactccatactcacctcacggggaggaaggtgatcacggtgctagcg
cgagaagggagagtgacagagatcgtgaatagggataatcactacagtccccatttccag
gagatccgaaagttaaagaaaattgtgactgttctcccaggtgatgtgctcattacttct
tgtacatacaacacagaagacagaaaactggcgactgtgggtgggtttagcatcacagaa
gaaatgtgtgtgaattacatacactactacccacagacacagttggaattatgtaagagt
gctgtggaccctggctacttacaaaaatattttcaccttattaacagcttcaacaatgaa
gataatggtaactactccaactcctctgtcaaagagcaatttgcttccgtctcttggaac
tcattcagccgtgatgtgctcaagtctctgtatgactttgccccaatctccatgcactgc
aacaaatcctcagcaatccggtttcctggtgaatgggaaaggcagcctttaccaaagatc
aagatgggattaaaagaggttactccacaatgccagaccattccaggactgtcacctgct
tcccctgccctggtcaacattgatgggaaaaaaggctag

DBGET integrated database retrieval system