KEGG   Sarcophilus harrisii (Tasmanian devil): 100925808Help
Entry
100925808         CDS       T02286                                 

Definition
(RefSeq) NADH-cytochrome b5 reductase 3
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100925808
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     100925808
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 100925808
NCBI-ProteinID: XP_023361288
Ensembl: ENSSHAG00000004857
Position
5
AA seq 301 aa AA seqDB search
MGSQLSTLGSFVLSPVWFIYSLFMKLFGKSAPPITLENPEVKYPLRLIDKENISHDTRRF
RFALPSPQHVLGLPIGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKIYFKDTNPK
FPAGGKMSQYLESLKTNDTIDFRGPSGLLIYRGKGKFAIRPDKKSEPAIKTVKSVGMIAG
GTGITPMLQLIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNQHSARFKLWFTVD
KAPEDWDYSQGFVNEDMIREHMPPPEAEPLILMCGPPPMIQYACIPNLDKVGYSKDLCFS
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggggagccagctgagcacgttgggtagcttcgtgctatctcctgtttggttcatctac
agcctcttcatgaagctttttgggaagtcggctcctcccatcaccttagagaaccctgag
gtgaagtacccactgaggctgattgacaaagagaatatcagccatgatacacggaggttc
cggttcgctctcccgtctccacagcacgttctggggctccccattggtcagcacatttac
ctctcagcccggatcgatgggaacctggtcatccggccctacacccccgtctccagcgac
gatgacaaaggtttcgtggatctggttatcaagatttacttcaaagacacgaaccccaag
tttcctgctggcgggaagatgtcccaatatctggagagtctgaaaactaatgacactatt
gacttcagaggccccagtggactgctgatctaccgtggtaaagggaagtttgccatccgt
cctgacaagaagtcggagcctgccatcaagacggtgaaatcagtgggcatgattgcagga
gggacaggtatcaccccgatgctgcagctaatccgtgccatcatgaaggaccccgacgac
cacaccgtctgccacctgctcttcgccaaccagacagagaaggacatcctgctgcgaccc
gagctggaggagctcaggaaccagcactcggcccgcttcaagctctggttcactgtggat
aaagccccggaagactgggactacagccagggcttcgtgaacgaggacatgatccgggag
cacatgcccccgcctgaggcggagcccctgatcctcatgtgcggccccccccctatgatc
cagtacgcctgcatccccaacctggacaaagtgggctactccaaagacctgtgcttctcc
ttctag

DBGET integrated database retrieval system