KEGG   Sarcophilus harrisii (Tasmanian devil): 100925913Help
Entry
100925913         CDS       T02286                                 

Gene name
CHP1
Definition
calcineurin-like EF hand protein 1
Orthology
K17610  
calcineurin B homologous protein 1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Protein phosphatases and associated proteins [BR:shr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100925913 (CHP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 195 aa AA seqDB search
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFR
LYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL
EKVDVEQKMSIRFLH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgggttctcgggcctccacgttattgcgggacgaagaactcgaggagataaaaaaagaa
accggcttctcccacagtcaaatcacccgtctctacagccggtttaccagcctggacaaa
ggagagaatggtactctcagccgggaagacttccagcggattccagagcttgccatcaac
cccctgggggatcggatcatcaatgccttcttccctgagggagaggaccaggtaaacttc
cgtggattcatgaggactttggctcactttcgaccaatcgaagataatgaaaaaagcaaa
gatgtgaatggaccagaaccactcaacagccggagcaataaactacactttgcctttcga
ttgtatgacttggataaagatgacaagatttctcgagatgaattgttacaggtactacgt
atgatggttggagtgaatatttcagatgagcagctgggcagcatcgcagataggacaatc
caagaagctgaccaggacggagacagtgccatatcctttacagagtttgtcaaggttttg
gagaaggtggacgtagagcagaagatgagcattcgatttcttcactaa

DBGET integrated database retrieval system