KEGG   Sarcophilus harrisii (Tasmanian devil): 100926139Help
Entry
100926139         CDS       T02286                                 

Gene name
PRKAA2
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-2 isoform X1
  KO
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
FoxO signaling pathway
Autophagy - animal
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Longevity regulating pathway - multiple species
Apelin signaling pathway
Tight junction
Circadian rhythm
Thermogenesis
Insulin signaling pathway
Adipocytokine signaling pathway
Oxytocin signaling pathway
Glucagon signaling pathway
Insulin resistance
Non-alcoholic fatty liver disease (NAFLD)
Hypertrophic cardiomyopathy (HCM)
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    100926139 (PRKAA2)
   04068 FoxO signaling pathway
    100926139 (PRKAA2)
   04151 PI3K-Akt signaling pathway
    100926139 (PRKAA2)
   04152 AMPK signaling pathway
    100926139 (PRKAA2)
   04150 mTOR signaling pathway
    100926139 (PRKAA2)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100926139 (PRKAA2)
  Cellular community - eukaryotes
   04530 Tight junction
    100926139 (PRKAA2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100926139 (PRKAA2)
   04922 Glucagon signaling pathway
    100926139 (PRKAA2)
   04920 Adipocytokine signaling pathway
    100926139 (PRKAA2)
   04921 Oxytocin signaling pathway
    100926139 (PRKAA2)
  Aging
   04211 Longevity regulating pathway - mammal
    100926139 (PRKAA2)
   04213 Longevity regulating pathway - multiple species
    100926139 (PRKAA2)
  Environmental adaptation
   04710 Circadian rhythm
    100926139 (PRKAA2)
   04714 Thermogenesis
    100926139 (PRKAA2)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100926139 (PRKAA2)
   05410 Hypertrophic cardiomyopathy (HCM)
    100926139 (PRKAA2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100926139 (PRKAA2)
   04931 Insulin resistance
    100926139 (PRKAA2)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100926139 (PRKAA2)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   100926139 (PRKAA2)
Membrane trafficking [BR:shr04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100926139 (PRKAA2)
Mitochondrial biogenesis [BR:shr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100926139 (PRKAA2)
  Mitophagy factors
   Other mitophagy factors
    100926139 (PRKAA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
4
AA seq 549 aa AA seqDB search
MCQGYFYFQVQYMGGMCKPWYMELWPRSAVGEHQLTGHKVAVKILNRQKIRSLDVVGKIK
REIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEETEARRLFQQ
ILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAP
EVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRSIA
TLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKFEC
TESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPTGSFMDDSAMHIPVG
LKPHPERMPPLVSDSPKAKCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMNEVYRA
MKQLDYEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYQVDNRSYLLDFKSIDDDLAEQKSG
SSTPQRSCSAAGLHRPRLSFDSTTADCHSLAGSLTGSLTGSVPSVAPRLGSHTMDFFEMC
ASLITTLAR
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcagggttatttttactttcaggttcagtatatgggaggaatgtgcaagccctgg
tacatggaattatggccaagatcagcagttggagaacaccagttgacaggccataaagtg
gcagtcaaaatcttaaatagacagaagattcgtagtttggatgtggttggaaaaatcaaa
cgagagattcaaaatctaaaactcttccgacatccccacattatcaaactataccaagtc
atcagcaccccaactgatttttttatggtaatggaatatgtgtctggtggtgaattattt
gactacatctgtaaacatggacgggttgaagagacagaggctagaagactctttcagcag
attctttctgctgtggattattgtcacagacacatggttgttcaccgagacctgaaaccc
gagaatgtgctgctggatgcccacatgaatgccaagattgccgactttggtttatcaaat
atgatgtcagatggtgaatttctgagaacgagctgtgggtctccaaattatgcagcacct
gaagtcatctcaggcaggttgtacgcggggcccgaggtggacatctggagctgcggcgtg
atcctgtacgccctgctctgcgggacgctgcccttcgatgatgagcacgtccccaccttg
tttaagaagatccgcgggggggtcttctacatcccggagtacctgaaccgttccatcgcc
actctgctcatgcacatgctgcaggtggaccctctgaaacgggccaccatcaaggacatc
agagaacacgagtggtttaaacaagacttacccagttatttatttcctgaagacccttcc
tatgatgcaaatgtcattgatgatgaagctgtgaaggaagtgtgtgaaaagtttgagtgc
acagagtccgaagtgatgaacagcctgtacagcggagacccccaggaccagctcgccgtg
gcttaccacctcatcatcgacaaccggcgcatcatgaaccaggccagcgagttctacctg
gcctccagcccgcccacgggctccttcatggacgacagcgccatgcacattcccgtcggg
ctgaagccgcaccccgagcgcatgccgcccctcgtctccgacagccccaaagccaagtgc
cccctggacgccctgaacacgaccaagcccaagtctctggctgtgaaaaaggccaagtgg
cacctgggcatccgcagtcagagcaaaccctacgatattatgaatgaggtctaccgggcc
atgaagcagctggattatgaatggaaggtggtaaatgcttatcatcttagagtgagaagg
aagaaccctgtgaccggcaattatgtgaaaatgagccttcagctgtaccaggtggacaat
cgaagttaccttttggacttcaagagtattgacgatgacctggcggagcagaagtccggc
tcctccacgccccagcgctcctgctctgctgccggcctacaccgaccaaggctgagcttc
gattcgaccacggccgactgccattctctcgctggatccttgacgggctccctgacgggg
agtgtgccttcggtagcgccgcgcctgggcagccacaccatggactttttcgaaatgtgc
gccagtctgatcactaccttagctcgctga

DBGET integrated database retrieval system