KEGG   Sarcophilus harrisii (Tasmanian devil): 100926192Help
Entry
100926192         CDS       T02286                                 

Gene name
GPT
Definition
(RefSeq) alanine aminotransferase 1
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00220  Arginine biosynthesis
shr00250  Alanine, aspartate and glutamate metabolism
shr01100  Metabolic pathways
shr01200  Carbon metabolism
shr01210  2-Oxocarboxylic acid metabolism
shr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100926192 (GPT)
   00220 Arginine biosynthesis
    100926192 (GPT)
Enzymes [BR:shr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     100926192 (GPT)
Amino acid related enzymes [BR:shr01007]
 Aminotransferase (transaminase)
  Class I
   100926192 (GPT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 100926192
NCBI-ProteinID: XP_023352434
Ensembl: ENSSHAG00000010134
Position
2
AA seq 543 aa AA seqDB search
MSVRAEVPWGPGKHPCWAWPGPSEGWSLYQLPSALHSRSTSAPRAVFRTMANKTIKQPVV
NGIRDKVLTMDTMNQSVKNIEYAVRGPILLRALELEKELQQGAKKPFTEIIRANIGDAHA
MGQRPITFMRQVLALCQYPDLLSSPSFPEDAKKRARRILQACEGHSAGSYSASAGIRTIR
EDVARYIEQRDGGIASDPENIFLSTGASSAIMAVLSLLVSGKGKNRTGVMIPIPQYPLYS
ATLAEYDAVQINYYLDEEHQWALDVAELRRALEQARAHCQPRGLCVINPGNPPGQVQSRE
NIEAVIRFAYEEHLFLLADEVYQDNVYAEGSQFHSFKKVLMEMGPPYAQQLELASFHSCS
KGYMGECGFRGGYTEVVNMDPAVKQQMLKLLSVRLCPPVPGQILMDIVTNPPQPGEPSYQ
QFQEEKKAVLADLAKKAQLTEEILNKEPGIQCNPVQGAMYSFPRIQLPPKALQHAKELGQ
PADMFFCIQLLEETGICVVPGSGFGQKDGTYHFRMTILPPLEKLKILLEKLSQFYAKFTR
EYS
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcagggccgaggttccttgggggccaggaaaacacccctgctgggcttggcct
gggccctccgagggctggagcctttaccagctcccgtctgctcttcactctcggtctact
tcagccccccgggcagtcttcaggaccatggcgaacaagactatcaagcagccggtggtg
aatgggatccgggacaaggtgctgaccatggacaccatgaaccagtcggtgaaaaacatc
gagtacgccgtgcgagggcccatcctgctgcgggctttggagctggagaaagagctgcag
cagggggcgaagaagcccttcacggagattatccgagccaatattggggacgcccacgcc
atgggccagaggcccatcactttcatgcgccaggtcttggcactctgccagtacccagac
ctcctgagcagcccgtccttcccggaagatgccaagaaacgcgccaggagaatcctgcag
gcctgtgagggccacagcgccgggtcttacagcgccagcgccggcatccggacgatccga
gaagatgtggcgaggtacattgagcagcgtgacgggggcattgcttctgaccctgagaac
atcttcctgtccacaggggccagcagtgccatcatggcggtgctgagcctgctagtgtcc
ggcaaagggaagaatcgcaccggggtcatgatccctatcccccagtacccactgtattca
gccaccctggccgagtacgacgcggtccagatcaactactacttggacgaggagcaccag
tgggccctcgatgtggccgagctgcggcgggccttagagcaggccagggcccattgccag
cctcggggcctatgcgtcatcaatcccggcaaccccccagggcaggtccagagccgggag
aacatcgaagctgtcatccggtttgcctacgaggagcatctcttcctgctggctgatgag
gtttaccaggacaatgtatatgctgagggatcccagtttcactcattcaagaaggtgcta
atggagatgggcccaccctatgcccagcagctggagctcgcttccttccactcctgctcc
aaaggatacatgggcgagtgtgggttccggggaggctacacagaagtagtgaatatggac
cctgcagtaaagcagcagatgttaaagttattgtcagttaggctgtgcccaccggtccca
gggcaaattctcatggacatagtgacaaatcctccccaacctggggaaccctcttatcag
cagttccaagaggagaaaaaggctgtgctggcagatctggcaaagaaggcccagctcaca
gaggagattttgaacaaggaacctggcatccaatgtaacccagtgcaaggggccatgtac
tctttcccccgcatccagctaccccccaaagcattgcagcatgcaaaggagctgggccag
cctgctgacatgttcttctgtatacaactcctggaggagactggtatctgtgtggtacct
ggcagtggctttggccagaaggatggcacctaccacttcaggatgaccattcttccccct
ttggagaagctgaagatccttctagagaaactgagtcaattttatgccaagtttactcgg
gaatattcctaa

DBGET integrated database retrieval system