KEGG   Sarcophilus harrisii (Tasmanian devil): 100926192Help
Entry
100926192         CDS       T02286                                 

Gene name
GPT
Definition
(RefSeq) glutamic--pyruvic transaminase
  KO
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100926192 (GPT)
   01210 2-Oxocarboxylic acid metabolism
    100926192 (GPT)
   01230 Biosynthesis of amino acids
    100926192 (GPT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100926192 (GPT)
   00220 Arginine biosynthesis
    100926192 (GPT)
Enzymes [BR:shr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     100926192 (GPT)
Amino acid related enzymes [BR:shr01007]
 Aminotransferase (transaminase)
  Class I
   100926192 (GPT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 494 aa AA seqDB search
MANKTIKQPVVNGIRDKVLTMDTMNQSVKNIEYAVRGPILLRALELEKELQQGAKKPFTE
IIRANIGDAHAMGQRPITFMRQVLALCQYPDLLSSPSFPEDAKKRARRILQACEGHSAGS
YSASAGIRTIREDVARYIEQRDGGIASDPENIFLSTGASSAIMAVLSLLVSGKGKNRTGV
MIPIPQYPLYSATLAEYDAVQINYYLDEEHQWALDVAELRRALEQARAHCQPRGLCVINP
GNPPGQVQSRENIEAVIRFAYEEHLFLLADEVYQDNVYAEGSQFHSFKKVLMEMGPPYAQ
QLELASFHSCSKGYMGECGFRGGYTEVVNMDPAVKQQMLKLLSVRLCPPVPGQILMDIVT
NPPQPGEPSYQQFQEEKKAVLADLAKKAQLTEEILNKEPGIQCNPVQGAMYSFPRIQLPP
KALQHAKELGQPADMFFCIQLLEETGICVVPGSGFGQKDGTYHFRMTILPPLEKLKILLE
KLSQFYAKFTREYS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacaagactatcaagcagccggtggtgaatgggatccgggacaaggtgctgacc
atggacaccatgaaccagtcggtgaaaaacatcgagtacgccgtgcgagggcccatcctg
ctgcgggctttggagctggagaaagagctgcagcagggggcgaagaagcccttcacggag
attatccgagccaatattggggacgcccacgccatgggccagaggcccatcactttcatg
cgccaggtcttggcactctgccagtacccagacctcctgagcagcccgtccttcccggaa
gatgccaagaaacgcgccaggagaatcctgcaggcctgtgagggccacagcgccgggtct
tacagcgccagcgccggcatccggacgatccgagaagatgtggcgaggtacattgagcag
cgtgacgggggcattgcttctgaccctgagaacatcttcctgtccacaggggccagcagt
gccatcatggcggtgctgagcctgctagtgtccggcaaagggaagaatcgcaccggggtc
atgatccctatcccccagtacccactgtattcagccaccctggccgagtacgacgcggtc
cagatcaactactacttggacgaggagcaccagtgggccctcgatgtggccgagctgcgg
cgggccttagagcaggccagggcccattgccagcctcggggcctatgcgtcatcaatccc
ggcaaccccccagggcaggtccagagccgggagaacatcgaagctgtcatccggtttgcc
tacgaggagcatctcttcctgctggctgatgaggtttaccaggacaatgtatatgctgag
ggatcccagtttcactcattcaagaaggtgctaatggagatgggcccaccctatgcccag
cagctggagctcgcttccttccactcctgctccaaaggatacatgggcgagtgtgggttc
cggggaggctacacagaagtagtgaatatggaccctgcagtaaagcagcagatgttaaag
ttattgtcagttaggctgtgcccaccggtcccagggcaaattctcatggacatagtgaca
aatcctccccaacctggggaaccctcttatcagcagttccaagaggagaaaaaggctgtg
ctggcagatctggcaaagaaggcccagctcacagaggagattttgaacaaggaacctggc
atccaatgtaacccagtgcaaggggccatgtactctttcccccgcatccagctacccccc
aaagcattgcagcatgcaaaggagctgggccagcctgctgacatgttcttctgtatacaa
ctcctggaggagactggtatctgtgtggtacctggcagtggctttggccagaaggatggc
acctaccacttcaggatgaccattcttccccctttggagaagctgaagatccttctagag
aaactgagtcaattttatgccaagtttactcgggaatattcctaa

DBGET integrated database retrieval system