KEGG   Sarcophilus harrisii (Tasmanian devil): 100926292Help
Entry
100926292         CDS       T02286                                 

Gene name
GK
Definition
(RefSeq) glycerol kinase
  KO
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100926292 (GK)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100926292 (GK)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     100926292 (GK)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100926292 (GK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3
AA seq 553 aa AA seqDB search
MREGPCEIGLSPPHCAAGNRETGTGVFNSKTAELLSHHQVELKQQFPKEGWVEQDPDEIL
QSVYECIERTCEKLTELNIDISAIKAIGVSNQRETTVVWDKYTGEPLYNAVVWLDLRTQG
TVETLSKRIPGNNNFVKSKTGLPLSTYFSAVKLHWILENVRDVKQAVEEERALFGTIDSW
LIWSLTGGPNGGVHCTDVTNASRTMLFNIHSLEWDIELCEFFEIPMTILPNIRSSSEIYG
LMKAGALEGVPLSGCLGDQSAALVGQMCFQDGQAKNTYGTGCFLLCNTGQKCVFSDHGLL
TTVAYKLGRDKPVCYALEGSVAIAGAVVRWLRDNLGIIESSEEIENLAKEAGTSYGCYFV
PAFSGLYAPYWEPSARGIICGLTQFTNKQHIAFAALEAVCFQTREILDAMNKDCGIPLSH
LQVDGGMTNNKILMQLQADILCIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSA
VTMERFEPQINEEESEIRYATWKKAVQKSMGWATGESPANAGDPNIFCSVPLGFFIVTSM
VMLIGARYISGIP
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaggggccttgtgaaataggactttcacctccccactgtgccgcgggaaaccga
gagactgggacgggtgttttcaattcaaaaacagctgaactacttagtcatcatcaagtg
gaactaaaacagcagttccctaaagaaggatgggtggaacaagatcctgatgagattctg
caatctgtctatgaatgtatagaaagaacttgtgagaaacttacggagttgaatattgac
atttctgctatcaaagctattggcgtgagcaatcagagagaaactactgtagtttgggac
aaatatactggagaacctctctacaatgctgttgtgtggcttgatctaagaacccagggt
acagttgaaacactaagtaaaagaattccaggaaataataattttgtcaagtccaagact
ggtctcccacttagcacttattttagcgctgtgaaacttcactggatcttagagaatgtg
agagatgttaaacaggctgttgaagaagaaagagctctttttggtaccattgattcatgg
ctcatctggagtttgacaggagggcctaatggaggtgtccattgtacagatgtaacaaat
gccagtaggacaatgcttttcaacattcattctttagaatgggatatagaactgtgcgag
ttttttgagattcctatgacaatacttccaaatatccggagttcttctgagatctatggt
ctaatgaaagctggggccttggaaggtgtgccattatcagggtgcttgggagaccagtct
gctgctttagttggacaaatgtgtttccaagatggacaagccaaaaatacgtatggaaca
ggctgtttccttctttgtaatacaggccaaaagtgtgttttttctgatcatggccttctt
accacagtggcttataaactgggcagagacaagccagtatgctatgcattggaaggatct
gttgctatagctggtgctgtcgttcgctggctaagagacaatcttggtattatagagtct
tcagaggaaattgaaaatcttgctaaagaggcgggcacttcttatggctgctactttgtt
ccagcattttcaggattatatgcaccatactgggagcccagtgcaagaggaattatttgt
ggccttactcagttcaccaataaacagcatattgcttttgctgcattagaagctgtttgt
ttccaaacaagagagattttggatgccatgaataaagactgtggaattccactcagccat
ttgcaagtagatggaggaatgaccaacaataaaattctcatgcaacttcaagcagatatt
ctttgtataccagtagtaaagccctcgatgcctgaaacaacagcactgggtgctgccatg
gcagcaggtgctgcagaaggagttggggtttggagtctggagcctgaagatttatcagct
gtcacaatggaacggtttgaacctcagatcaatgaagaagaaagtgaaattcgttatgcc
acttggaaaaaagctgtgcagaaatcaatgggctgggctacgggagagtctcctgcaaat
gcaggtgaccctaatatcttctgtagtgtgccattgggcttttttatagtgactagcatg
gtaatgttaatcggagcaaggtacatctcaggtattccataa

DBGET integrated database retrieval system