KEGG   Sarcophilus harrisii (Tasmanian devil): 100926292Help
Entry
100926292         CDS       T02286                                 

Definition
glycerol kinase-like
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:shr00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:shr03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 558 aa AA seqDB search
MREGPCEIGLSPPHCAAGNRETGTGVFNSKTAELLSHHQVELKQQFPKEGWVEQDPDEIL
QSVYECIERTCEKLTELNIDISAIKAIGVSNQRETTVVWDKYTGEPLYNAVVWLDLRTQG
TVETLSKRIPGNNNFVKSKTGLPLSTYFSAVKLHWILENVRDVKQAVEEERALFGTIDSW
LIWSLTGGPNGGVHCTDVTNASRTMLFNIHSLEWDIELCEFFEIPMTILPNIRSSSEIYG
LMKISHSLKAGALEGVPLSGCLGDQSAALVGQMCFQDGQAKNTYGTGCFLLCNTGQKCVF
SDHGLLTTVAYKLGRDKPVCYALEGSVAIAGAVVRWLRDNLGIIESSEEIENLAKEAGTS
YGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKQHIAFAALEAVCFQTREILDAMNKDC
GIPLSHLQVDGGMTNNKILMQLQADILCIPVVKPSMPETTALGAAMAAGAAEGVGVWSLE
PEDLSAVTMERFEPQINEEESEIRYATWKKAVQKSMGWATGESPANGDPNIFCSVPLGFF
IVTSMVMLIGARYISGIP
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaggggccttgtgaaataggactttcacctccccactgtgccgcgggaaaccga
gagactgggacgggtgttttcaattcaaaaacagctgaactacttagtcatcatcaagtg
gaactaaaacagcagttccctaaagaaggatgggtggaacaagatcctgatgagattctg
caatctgtctatgaatgtatagaaagaacttgtgagaaacttacggagttgaatattgac
atttctgctatcaaagctattggcgtgagcaatcagagagaaactactgtagtttgggac
aaatatactggagaacctctctacaatgctgttgtgtggcttgatctaagaacccagggt
acagttgaaacactaagtaaaagaattccaggaaataataattttgtcaagtccaagact
ggtctcccacttagcacttattttagcgctgtgaaacttcactggatcttagagaatgtg
agagatgttaaacaggctgttgaagaagaaagagctctttttggtaccattgattcatgg
ctcatctggagtttgacaggagggcctaatggaggtgtccattgtacagatgtaacaaat
gccagtaggacaatgcttttcaacattcattctttagaatgggatatagaactgtgcgag
ttttttgagattcctatgacaatacttccaaatatccggagttcttctgagatctatggt
ctaatgaaaatctctcatagcctgaaagctggggccttggaaggtgtgccattatcaggg
tgcttgggagaccagtctgctgctttagttggacaaatgtgtttccaagatggacaagcc
aaaaatacgtatggaacaggctgtttccttctttgtaatacaggccaaaagtgtgttttt
tctgatcatggccttcttaccacagtggcttataaactgggcagagacaagccagtatgc
tatgcattggaaggatctgttgctatagctggtgctgtcgttcgctggctaagagacaat
cttggtattatagagtcttcagaggaaattgaaaatcttgctaaagaggcgggcacttct
tatggctgctactttgttccagcattttcaggattatatgcaccatactgggagcccagt
gcaagaggaattatttgtggccttactcagttcaccaataaacagcatattgcttttgct
gcattagaagctgtttgtttccaaacaagagagattttggatgccatgaataaagactgt
ggaattccactcagccatttgcaagtagatggaggaatgaccaacaataaaattctcatg
caacttcaagcagatattctttgtataccagtagtaaagccctcgatgcctgaaacaaca
gcactgggtgctgccatggcagcaggtgctgcagaaggagttggggtttggagtctggag
cctgaagatttatcagctgtcacaatggaacggtttgaacctcagatcaatgaagaagaa
agtgaaattcgttatgccacttggaaaaaagctgtgcagaaatcaatgggctgggctacg
ggagagtctcctgcaaatggtgaccctaatatcttctgtagtgtgccattgggctttttt
atagtgactagcatggtaatgttaatcggagcaaggtacatctcaggtattccataa

DBGET integrated database retrieval system