KEGG   Sarcophilus harrisii (Tasmanian devil): 100926299Help
Entry
100926299         CDS       T02286                                 

Gene name
CLK1
Definition
CDC-like kinase 1
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100926299 (CLK1)
Protein kinases [BR:shr01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   100926299 (CLK1)
Spliceosome [BR:shr03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100926299 (CLK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 485 aa AA seqDB search
MRHSKRTDCPDWFEKDSWDRRKWSSSISGHKRRKRSHSSSRENKRCKHNHSKIYDRHYLE
ARCINERDYRNRRYIDEYRNDYCQGYESGYHHREQESGYYNHSSKSSGRSGRSHYKRKHK
SHRSTHRSHVKSHRRKRSRSVEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECID
HKAGGRRVAVKIVKNVDRYSEAAHSEIQVLEHINSTDPNSTFRCVQMLEWFEHLGHVCIV
FELLGLSTYDFIKENSFLPFRMDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVQSD
YTEEYNPNMRRDERTVKNPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWAQPC
DVWSIGCILIEYYLGFTIFPTHDSKEHLAMMERILGPLPKHMIQKTRIQKYFRHYQLDWD
EHSSAGRYVQRRCKPLKEFMHSQDADHELLFDLIQKMLEYDPTKRITLKEALKHPFFFSL
KKENM
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcgacattcaaagagaaccgattgccctgattggtttgaaaaggacagttgggatcgc
agaaaatggagtagcagtatcagtggtcataagcgaaggaagagatctcatagcagttcc
cgggagaacaagcgctgcaagcacaatcactcaaaaatttatgatcgccattatttggaa
gccagatgtataaatgagagagattatcgtaatcgacgctacattgatgaatatagaaat
gactactgtcaaggatatgaaagtggatatcaccatagagaacaagaaagtggttattac
aatcacagtagcaagtcctctggtagaagtggaagaagtcattataaaagaaaacacaag
agtcaccgcagtactcatcgctcacatgtgaagagtcaccgaaggaaaagatccaggagt
gtagaggatgatgaggagggtcacctgatctgtcagagtggagacgtactaagtgcaaga
tatgaaattgttgatactttaggcgaaggagcttttggaaaagttgtggaatgcatcgat
cataaagcggggggtagacgtgtagcagtaaaaatagtgaaaaatgtggatagatattct
gaagcagctcattcagaaatacaagttttggaacacataaactcaacagatcctaacagt
acatttcgctgtgttcagatgttggaatggtttgagcatcttggtcatgtttgcattgtg
tttgaacttctgggacttagcacttatgactttattaaagaaaatagctttttgccattt
cgaatggatcacatcaggaaaatggcgtatcaaatatgcaaatctgttaactttttgcac
agcaataaactaactcatactgatctgaagcctgaaaatattttgtttgtgcagtcagac
tacacagaagagtataatcctaatatgagacgtgatgaacgtacagtaaaaaatccagat
attaaggttgttgactttggaagtgcaacatatgatgatgaacaccacagtaccttggtt
tctacaagacattatagagcacctgaagtaattttagctctaggatgggctcagccatgt
gatgtttggagtataggatgtattctcatcgagtattacttgggattcacaatatttcct
acacatgacagtaaggaacatttggcaatgatggaaaggattttgggacctttaccaaaa
cacatgattcagaaaaccaggatacaaaaatatttccgtcattaccaattagattgggac
gagcacagttctgctggtagatatgttcaacggcgttgtaaaccattaaaggaatttatg
cattctcaagatgctgaccatgagcttctctttgacctcatccagaaaatgttagagtat
gatccaactaaaagaattactcttaaagaagccttgaagcatcctttctttttttcactg
aagaaagaaaatatgtga

DBGET integrated database retrieval system