KEGG   Sarcophilus harrisii (Tasmanian devil): 100926312Help
Entry
100926312         CDS       T02286                                 

Gene name
ARG1
Definition
(RefSeq) arginase, liver
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100926312 (ARG1)
  Amino acid metabolism
   00220 Arginine biosynthesis
    100926312 (ARG1)
   00330 Arginine and proline metabolism
    100926312 (ARG1)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    100926312 (ARG1)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100926312 (ARG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 315 aa AA seqDB search
MSSKPKSIGIIGGPFSKGQPRGGVEEGPAVLRKAGLVERLQELGCDVKDYGNLSFVDVTN
DTPFQIVKNPRTVGKANEQLAEVVAEVKKNGRISLVLGGDHSLAIGTISGHAKVHPDLCV
IWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPELPGFSWVTPCLSAKDIVYIGLR
DVDPGEHRILKDLGIKFFSMTEVDKLGIGKVMEETLSYLIGRKKRPIHLSYDVDGLDPSF
TPATGTPVPGGLTYREGIYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVNRTVNTAVALT
LSCFGVAREGNHSDK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagttccaagccaaagtcaattgggatcatcggaggacctttctccaaaggacagcca
cgaggaggggtagaagaaggccctgcagtgctgagaaaggctggcctagttgaaagactt
caagaactagggtgtgacgtgaaagattatgggaacttgtcttttgttgatgtgaccaat
gataccccctttcaaattgtgaagaatccaaggactgtgggtaaagctaatgagcagctg
gctgaagtagtcgcagaagtaaagaagaatgggagaatcagtttggtacttggcggggat
cacagtttggcaattggaaccatctctggccatgctaaggttcatccagatctctgcgtc
atttgggtagatgcacatactgatatcaacactcctttgacaaccacaagtggaaactta
catggacagcctgtgtctttccttttgaaggaactaaaaggaaagattcctgaacttcca
ggattctcttgggtgacaccctgcttatcagctaaggacattgtgtatattggattgaga
gatgtggatcctggtgaacatcgcatccttaaagatctgggtattaaatttttttcaatg
actgaagtagataagcttggaattggcaaagtaatggaagaaacactaagttacttaata
ggaaggaaaaaaagaccaattcatctgagttatgatgtggatgggttggatccatctttc
acaccagctactggcactcctgtccctggaggcctgacttacagagaaggtatctatatt
acagaagaaatctataaaacagggctcctctcgggattagacataatggaagtcaatcca
tcccttgggaaaacaccagaagaagtaaaccggacagtaaacacggctgttgcattaact
ttgtcctgctttggagtagctcgagagggaaatcatagtgacaaataa

DBGET integrated database retrieval system