KEGG   Sarcophilus harrisii (Tasmanian devil): 100926508Help
Entry
100926508         CDS       T02286                                 

Gene name
KAT2B
Definition
(RefSeq) lysine acetyltransferase 2B
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100926508 (KAT2B)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100926508 (KAT2B)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100926508 (KAT2B)
  Infectious diseases
   05166 HTLV-I infection
    100926508 (KAT2B)
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100926508 (KAT2B)
Transcription machinery [BR:shr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100926508 (KAT2B)
Chromosome [BR:shr03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100926508 (KAT2B)
   HAT complexes
    PCAF complex
     100926508 (KAT2B)
    STAGA complex
     100926508 (KAT2B)
    TFTC complex
     100926508 (KAT2B)
    SAGA complex
     100926508 (KAT2B)
    SLIK complex
     100926508 (KAT2B)
    ADA-HAT complex
     100926508 (KAT2B)
    HAT-A2 complex
     100926508 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 734 aa AA seqDB search
MKPYAEESCKCNGWKNPNPPPTPPRADVQQIIVSLTESCRSCSHALAAHVSHLENVSEEE
MNRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKCILQMGKPVVEGSLESPPFEK
PSIEQGVNNFVHYKFSHLPSKERQTIVELAKMFLNRINYWHLETPSQRRLRSPNDDVAGY
KVNYTRWLCYCHVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEK
RTLILTHFPKFLSMLEEEVYSQSSPIWDPDFLAASSHAGQLGIQTVINPPPVARTVSYNG
SPSSLEQPIGGSLSPVCKVSSGLEGNRGEKRKMNDLHSLEEAKRPRVVGDIPIELINEVM
STITDPAAMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKKIMMWLVGL
QNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTS
NEQVKGYGTHLMNHLKEYHIKHSILNFLTYADEYAIGYFKKQGFSKDIKVPKTKYVGYIK
DYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQI
PIESIPGIRETGWKPSGKERGKEPKDPDQLYSTLKNILQQVKSHQSAWPFMEPVKRTEAP
GYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEK
FFFTKIKEAGLIDK
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgaagccatatgccgaggaatcttgtaaatgtaatggctggaaaaaccccaatcccccg
cccactcctccccgggcagacgtgcagcagataattgtcagtctcactgagtcctgccgt
agttgtagccacgctctcgctgctcatgtgtctcacctggagaatgtgtcagaggaagaa
atgaatcggctccttggcatagtgttggatgtggaatatctcttcacttgtgttcacaaa
gaagaagatgcagataccaaacaagtttatttctatctgtttaagcttttgagaaaatgc
attttacaaatggggaaaccagtagtcgaaggatccttggagagccctccatttgagaag
cctagtattgaacagggtgtgaataattttgtacattacaagtttagccacctaccctcc
aaagagagacagacgatagtagaactggccaagatgtttctaaatcgcatcaactattgg
cacctggagacgccatctcagcgaagattacgatctccaaacgatgatgttgcaggatac
aaagtgaactacaccaggtggctgtgctactgtcacgtgcctcagttctgcgacagtctc
cctcggtatgagaccactcaggtgttcgggagaacgctgctgcgctccgtcttcactgtg
atgagacggcagctcctggaacaagcccggcaggagaaggacaagctacccctggagaag
cggacgctcatcctcacccatttcccaaagtttctttccatgttagaagaagaagtttat
agccagagttcgcctatctgggatccagactttctggctgcctcttctcatgctggtcag
ctaggaatccaaacagtcatcaatcctcctcctgtggctaggactgtgtcatacaacggg
agcccttcctctctggagcagcccattggaggaagcttgagtcctgtctgtaaagtctct
tctggactggaagggaaccgaggagagaagagaaaaatgaacgaccttcattccctggag
gaggccaagagacccagagttgtaggggatattcccattgagttgatcaatgaagtcatg
tctaccattacagaccctgccgcaatgctgggaccagagaccaactttctatcagcacat
tcagcccgggatgaagccgccaggctggaagagcgccggggtgtgatagaattccatgtg
gttggcaactctctgaatcagaagcctaacaaaaagatcatgatgtggctggttggctta
cagaatgtcttctctcatcagctccctagaatgcccaaagagtatatcacacgcctcgtc
tttgaccctaagcacaagactcttgctctgattaaagatggccgtgtgattggtgggatc
tgtttccgaatgttcccatcacaaggattcacggagattgtcttctgtgccgtaacttcc
aatgagcaagtcaagggctatggaactcacctcatgaatcacctgaaagaataccatata
aaacatagcatcctgaactttcttacgtatgctgacgaatatgcaattggatacttcaag
aaacaaggtttctccaaagatatcaaagtacccaaaaccaaatacgttggctacatcaag
gactatgaaggagccacactgatgggctgtgaattaaacccccggatcccatacacagaa
ttttctgtcatcatcaaaaaacagaaagagataattaagaagctgatagaaaggaagcaa
gcccagattcgaaaggtctaccctggactttcgtgttttaaagacggagtacgccagatt
ccaatagaaagcattcctggcattagagagacaggctggaaaccaagtggaaaagaaaga
ggcaaagagcccaaagatcctgatcagctttacagcacattaaagaacatcctgcagcag
gtgaagagccatcaaagcgcttggcccttcatggaacccgtgaagagaacggaagctccc
ggatattatgaagttataaggttccctatggatttgaaaaccatgagtgaacggctcaag
aataggtactacgtatctaagaaattattcatggcagacttacagcgggtatttaccaat
tgcaaagagtacaacccccctgagagcgaatactacaaatgtgccaatatcctggagaaa
ttcttcttcaccaaaattaaggaagctggattaattgacaagtga

DBGET integrated database retrieval system