KEGG   Sarcophilus harrisii (Tasmanian devil): 100926540Help
Entry
100926540         CDS       T02286                                 

Gene name
RAD54B
Definition
(RefSeq) DNA repair and recombination protein RAD54B isoform X1
  KO
K10877  DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    100926540 (RAD54B)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     100926540 (RAD54B)
DNA repair and recombination proteins [BR:shr03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Rad54 family proteins
     100926540 (RAD54B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF2_N Helicase_C ResIII HDA2-3 Rubella_E1
Motif
Other DBs
NCBI-GeneID: 100926540
NCBI-ProteinID: XP_003760306
Ensembl: ENSSHAG00000017038
UniProt: G3WXC9
Position
2
AA seq 912 aa AA seqDB search
MRRSAAPSQLQGSLAKKLRFRPPGNISTSDLNEKIDKQGPNATFTEVGTTKNPLLRFQTD
SKICTSVLSAVTSEESVRSINDVDKSTGNYSFKATGKVSVDATNTALVAAEVAQLEEKEA
ISDHVTKYFSVVWRKVSKKKHKKWEGDAVLIVSGRSFTLKDLEGKDIGRGTGYKLKDLDS
LNEGEATVIGGKEIEVMGIISSDDYKSGRCFQSSLGSPCLTPSQITRKPFSNPVKSSCKS
NTKEKIVDDSPNFKPRHDPYAQNSFVMPRPDKSHQWIFNKNCLPLVDVVVDPYLVHHLRP
HQKEGIVFLYECVMGMRMNGRFGAILADEMGLGKTLQCISLVWTLLRQGLYGGKPIIKKT
LIVTPGSLVTNWKKEFQKWLGSERIKVFTVDQDHKIEDFVNSPLYSVLVISYEMLLRCLD
QIKNIKFDLLICDEGHRLKNSSIKTTTALVGLSCEKRVILTGTPIQNDLQEFYALIEFVN
PGILGSLSSYRKIYEEPIIASREPSATEEEKKLGEKRAAELTRLTGLFILRRTQEVINKY
LPPKIENVVFCRPGRLQIELYRKLLDSQAVRFCLQGVLENSPHLICIGALKKLCNHPCLL
FKSLKEKECNSSSDEYEEYNFSESLIDAYPADYNPLTFSETDSGKLHVLTKLLAVIHELS
PSEKVVLVSNYTQTLNILQEVCKRHGYNCSRLDGQTPVVQRQQIVDGFNSKHSSDFVFLL
SSKAGGVGLNLIGGSHLILYDIDWNPATDIQAMARVWRDGQKHSVHIYRLLTTGTIEEKI
YQRQISKQGLSGAVVDLSKTSEHIQFSVEELKNLFTLHEDSDCVTHDLLDCECMGRKDHQ
AKPLEEVHTYRKCQLGPNHLKPDSKKPLSMSQLKQWKHFSGKYQNINDPFLERIKENVSF
IFQNITNQAPLT
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgagaagatctgcagcaccaagtcaattacaggggagtttagcaaaaaaactaagattt
agacctccaggaaatattagtacatcagatctcaatgagaagattgataaacagggtcca
aatgctacatttactgaggttggtacaactaaaaatcccctgctgcgttttcagactgat
tctaaaatttgtacttcagttctaagtgctgtgacttctgaagaatctgttagatcaata
aatgatgtggataagtccacaggaaattattcatttaaggcaactggaaaggtgtcagtg
gatgcaactaatacagcacttgtagcagcagaagtagcccagctagaagaaaaagaagcc
atatctgaccacgtgacaaaatatttcagtgttgtttggcgtaaagtttcaaagaagaaa
cacaaaaagtgggaaggtgatgctgtccttattgtgagcgggaggtcattcaccttgaag
gatctggagggcaaagacattggaagaggcactggatataaattgaaagatttggacagt
ttaaatgagggtgaagcaacagtgattggtggaaaagaaatagaggtcatgggtataatt
tcttcagatgattacaaaagtggtagatgttttcagtctagcttagggagcccatgcctc
acaccttcacaaattacccggaagcctttttctaatccagttaaaagtagctgcaaatcc
aacacaaaagaaaagattgtagatgattccccaaatttcaaacctcgtcatgatccatat
gcacaaaattcctttgttatgccacgaccagataaaagtcatcagtggatattcaataag
aactgtttaccacttgtggatgtagttgtagatccctaccttgtacatcatcttcgacca
caccaaaaagaaggaattgtgtttctttatgaatgcgtgatgggaatgagaatgaatggc
agatttggtgctattcttgctgatgaaatgggtttggggaaaacactgcaatgtatttcg
ctcgtctggacactcctgcgtcagggactctatggaggcaaaccaattattaaaaagaca
cttattgttacccctggaagtttagtgactaattggaaaaaagaatttcagaaatggtta
ggaagtgaaagaattaaagtgttcactgttgatcaggatcacaaaatagaagactttgtc
aactccccgctgtattcagtacttgtcatcagttatgagatgctgcttcgatgccttgat
caaattaaaaatataaaatttgatcttttaatctgtgatgaaggacatcgcttgaagaac
agttccattaagacaactacagcccttgttggcctgtcttgtgagaagagagtaattcta
actggtaccccaattcaaaatgatttacaggaattttatgcattaattgaatttgtgaat
ccaggaatactaggctctttgtcatcatatagaaaaatatatgaagaacccattattgca
tcccgagaaccttctgctacggaggaagaaaaaaaattgggagagaaaagagcagctgaa
ctcactcgccttactggactctttattcttagaagaacacaagaggtgataaataaatat
cttccacctaaaatagagaatgtagtcttctgcagacctggaagactacagattgaactt
tatcggaaactgttggattctcaggctgtcaggttttgtctgcagggggtactagaaaat
agtcctcatctgatttgtataggagctcttaaaaaactgtgcaaccacccctgtcttctc
ttcaaatctttaaaggaaaaagaatgtaactcatcttctgatgaatatgaagaatataac
ttttctgaaagcttgatagatgcctatcctgcggattacaaccctctcacattttctgag
acagattcaggaaaactacatgtcttgacaaagctgttagcagtaatccatgaactcagt
ccttctgaaaaggtagtactggtatctaattatacacaaaccctaaatattttacaagaa
gtctgcaagcgtcatggatataattgttcaagactcgatggacaaaccccagttgtacag
agacagcaaattgttgatggattcaatagcaaacactcatcagattttgtatttttatta
agttcaaaggctggtggtgtgggactaaaccttattggaggttctcatttaattttgtat
gatattgattggaatccagctactgatatccaggcaatggctagagtgtggcgagatggt
cagaaacattctgtacatatctacagacttctcacaacaggcacaattgaagaaaagatt
tatcaaagacagatcagtaagcaaggtctttctggggcagttgtagacctgtctaagaca
tctgagcatatccagttttcggtagaagaactgaaaaatttgttcaccttacatgaagat
tcagattgtgttacccatgatctactagattgtgagtgtatgggaaggaaagaccatcaa
gccaaacctttggaagaagtccatacatacagaaaatgccagcttggcccaaatcacctt
aaacctgactccaaaaaacccctttccatgtcacagctgaaacaatggaaacacttctct
gggaaatatcagaatattaatgatccctttcttgaaagaattaaagaaaacgtttctttc
atttttcaaaatataaccaatcaagctcctctaacataa

DBGET integrated database retrieval system