KEGG   Sarcophilus harrisii (Tasmanian devil): 100926540Help
Entry
100926540         CDS       T02286                                 

Gene name
RAD54B
Definition
RAD54 homolog B (S. cerevisiae)
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:shr03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 912 aa AA seqDB search
MRRSAAPSQLQGSLAKKLRFRPPGNISTSDLNEKIDKQGPNATFTEVGTTKNPLLRFQTD
SKICTSVLSAVTSEESVRSINDVDKSTGNYSFKATGKVSVDATNTALVAAEVAQLEEKEA
ISDHVTKYFSVVWRKVSKKKHKKWEGDAVLIVSGRSFTLKDLEGKDIGRGTGYKLKDLDS
LNEGEATVIGGKEIEVMGIISSDDYKSGRCFQSSLGSPCLTPSQITRKPFSNPVKSSCKS
NTKEKIVDDSPNFKPRHDPYAQNSFVMPRPDKSHQWIFNKNCLPLVDVVVDPYLVHHLRP
HQKEGIVFLYECVMGMRMNGRFGAILADEMGLGKTLQCISLVWTLLRQGLYGGKPIIKKT
LIVTPGSLVTNWKKEFQKWLGSERIKVFTVDQDHKIEDFVNSPLYSVLVISYEMLLRCLD
QIKNIKFDLLICDEGHRLKNSSIKTTTALVGLSCEKRVILTGTPIQNDLQEFYALIEFVN
PGILGSLSSYRKIYEEPIIASREPSATEEEKKLGEKRAAELTRLTGLFILRRTQEVINKY
LPPKIENVVFCRPGRLQIELYRKLLDSQAVRFCLQGVLENSPHLICIGALKKLCNHPCLL
FKSLKEKECNSSSDEYEEYNFSESLIDAYPADYNPLTFSETDSGKLHVLTKLLAVIHELS
PSEKVVLVSNYTQTLNILQEVCKRHGYNCSRLDGQTPVVQRQQIVDGFNSKHSSDFVFLL
SSKAGGVGLNLIGGSHLILYDIDWNPATDIQAMARVWRDGQKHSVHIYRLLTTGTIEEKI
YQRQISKQGLSGAVVDLSKTSEHIQFSVEELKNLFTLHEDSDCVTHDLLDCECMGRKDHQ
AKPLEEVHTYRKCQLGPNHLKPDSKKPLSMSQLKQWKHFSGKYQNINDPFLERIKENVSF
IFQNITNQAPLT
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgagaagatctgcagcaccaagtcaattacaggggagtttagcaaaaaaactaagattt
agacctccaggaaatattagtacatcagatctcaatgagaagattgataaacagggtcca
aatgctacatttactgaggttggtacaactaaaaatcccctgctgcgttttcagactgat
tctaaaatttgtacttcagttctaagtgctgtgacttctgaagaatctgttagatcaata
aatgatgtggataagtccacaggaaattattcatttaaggcaactggaaaggtgtcagtg
gatgcaactaatacagcacttgtagcagcagaagtagcccagctagaagaaaaagaagcc
atatctgaccacgtgacaaaatatttcagtgttgtttggcgtaaagtttcaaagaagaaa
cacaaaaagtgggaaggtgatgctgtccttattgtgagcgggaggtcattcaccttgaag
gatctggagggcaaagacattggaagaggcactggatataaattgaaagatttggacagt
ttaaatgagggtgaagcaacagtgattggtggaaaagaaatagaggtcatgggtataatt
tcttcagatgattacaaaagtggtagatgttttcagtctagcttagggagcccatgcctc
acaccttcacaaattacccggaagcctttttctaatccagttaaaagtagctgcaaatcc
aacacaaaagaaaagattgtagatgattccccaaatttcaaacctcgtcatgatccatat
gcacaaaattcctttgttatgccacgaccagataaaagtcatcagtggatattcaataag
aactgtttaccacttgtggatgtagttgtagatccctaccttgtacatcatcttcgacca
caccaaaaagaaggaattgtgtttctttatgaatgcgtgatgggaatgagaatgaatggc
agatttggtgctattcttgctgatgaaatgggtttggggaaaacactgcaatgtatttcg
ctcgtctggacactcctgcgtcagggactctatggaggcaaaccaattattaaaaagaca
cttattgttacccctggaagtttagtgactaattggaaaaaagaatttcagaaatggtta
ggaagtgaaagaattaaagtgttcactgttgatcaggatcacaaaatagaagactttgtc
aactccccgctgtattcagtacttgtcatcagttatgagatgctgcttcgatgccttgat
caaattaaaaatataaaatttgatcttttaatctgtgatgaaggacatcgcttgaagaac
agttccattaagacaactacagcccttgttggcctgtcttgtgagaagagagtaattcta
actggtaccccaattcaaaatgatttacaggaattttatgcattaattgaatttgtgaat
ccaggaatactaggctctttgtcatcatatagaaaaatatatgaagaacccattattgca
tcccgagaaccttctgctacggaggaagaaaaaaaattgggagagaaaagagcagctgaa
ctcactcgccttactggactctttattcttagaagaacacaagaggtgataaataaatat
cttccacctaaaatagagaatgtagtcttctgcagacctggaagactacagattgaactt
tatcggaaactgttggattctcaggctgtcaggttttgtctgcagggggtactagaaaat
agtcctcatctgatttgtataggagctcttaaaaaactgtgcaaccacccctgtcttctc
ttcaaatctttaaaggaaaaagaatgtaactcatcttctgatgaatatgaagaatataac
ttttctgaaagcttgatagatgcctatcctgcggattacaaccctctcacattttctgag
acagattcaggaaaactacatgtcttgacaaagctgttagcagtaatccatgaactcagt
ccttctgaaaaggtagtactggtatctaattatacacaaaccctaaatattttacaagaa
gtctgcaagcgtcatggatataattgttcaagactcgatggacaaaccccagttgtacag
agacagcaaattgttgatggattcaatagcaaacactcatcagattttgtatttttatta
agttcaaaggctggtggtgtgggactaaaccttattggaggttctcatttaattttgtat
gatattgattggaatccagctactgatatccaggcaatggctagagtgtggcgagatggt
cagaaacattctgtacatatctacagacttctcacaacaggcacaattgaagaaaagatt
tatcaaagacagatcagtaagcaaggtctttctggggcagttgtagacctgtctaagaca
tctgagcatatccagttttcggtagaagaactgaaaaatttgttcaccttacatgaagat
tcagattgtgttacccatgatctactagattgtgagtgtatgggaaggaaagaccatcaa
gccaaacctttggaagaagtccatacatacagaaaatgccagcttggcccaaatcacctt
aaacctgactccaaaaaacccctttccatgtcacagctgaaacaatggaaacacttctct
gggaaatatcagaatattaatgatccctttcttgaaagaattaaagaaaacgtttctttc
atttttcaaaatataaccaatcaagctcctctaacataa

DBGET integrated database retrieval system