KEGG   Sarcophilus harrisii (Tasmanian devil): 100926683Help
Entry
100926683         CDS       T02286                                 

Gene name
PFKM
Definition
(RefSeq) phosphofructokinase, muscle
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
AMPK signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100926683 (PFKM)
   01230 Biosynthesis of amino acids
    100926683 (PFKM)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100926683 (PFKM)
   00030 Pentose phosphate pathway
    100926683 (PFKM)
   00051 Fructose and mannose metabolism
    100926683 (PFKM)
   00052 Galactose metabolism
    100926683 (PFKM)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    100926683 (PFKM)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100926683 (PFKM)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100926683 (PFKM)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100926683 (PFKM)
Protein phosphatases and associated proteins [BR:shr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100926683 (PFKM)
Messenger RNA biogenesis [BR:shr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100926683 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 780 aa AA seqDB search
MKHDAHLQAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGLYTGAKVFFVHEGYQGLVD
GGDNIKEANWGSVSMIVQLGGTVIGSARCKDFLERPGRLQAACNLVKLGITNLCVIGGDG
SLTGADTFRAEWSSLLADLQKEGKITEEEAKKSSYLNIVGLVGSIDNDFCGTDMTIGTDS
ALHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALITSIACGADWVFVPECPPDDDWE
DHLCRRLTETRCRGSRLNIIIVAEGAIDRHGKPITSENIKDLVMKRLGYDTRVTVLGHVQ
RGGTPSAFDRILGSRMGMEAVMALLEGTPDTPACVVTLSGNQAVRLPLMECVQVTKDVTR
AMQNKKFDEAMKLRGRSFQNNWDVYTRLAHVKAPTISQVKNVVAVMNVGAPAAGMNAAVR
SSVRIGLIQGNQVLVVHDGFEGLAKGQIEEVGWTYVGGWTGQGGAKLGTKRTLPKKLFKE
ISANITKFKIQGLIIIGGFEAYTGALELMEGRAKFEELCIPYVVIPATVSNNVPGSDFSI
GADTALNAICMTCDRLKQSAEGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPF
NIHDLQANVEHLVQKMKTTVKRGLIVRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLG
HMQQGGSPSPFDRNFATKMGAKAMTWISTKIQENVRNGRVFANSPDSACVLGMRRRALIF
QPLSDLKEETDFEHRIPREQWWMKIRPLLKILAKYDTDLDTTDHAHLEHIKRMSVESASP
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatgacgcacatcttcaggcgaaaacactgggtattggcaaagccatcgccgta
ctcacctctgggggagatgcccaaggtatgaatgctgctgtccgagctgtggtgcgtgtt
gggctctacactggagcaaaggttttctttgtccatgagggttatcaaggcctagtagat
ggaggagataacataaaggaagccaactggggaagtgtttccatgatcgtccagctggga
ggcacagtgataggtagtgcccggtgcaaagatttccttgaacgtccaggtcgacttcaa
gctgcctgcaaccttgtgaaacttgggatcaccaatttatgtgtcattggaggggacggc
agcctcactggagcagacactttccgtgctgaatggagtagcctgttggctgacttacag
aaagaaggcaagatcacagaagaagaggcgaagaagtccagttacctgaatattgtgggc
ttggttggttccattgacaatgacttctgtggcacagacatgaccattggtactgattct
gccctacaccgtattatagagattgtggatgctatcaccactacagcccaaagtcaccag
aggacttttgtattggaggtgatgggccggcactgtggatatcttgccttgatcacttct
attgcctgtggagctgactgggtttttgttcctgagtgtccaccagatgacgattgggag
gatcatctttgccgccggctcactgagacaaggtgccgtggttcccgtctcaacatcatc
attgtggctgaaggagcaattgacaggcatgggaaacccatcacgtctgagaacatcaag
gatctggtgatgaagcgtttgggatatgatacacgcgtcactgtcctgggacatgtgcaa
cggggtggtaccccttcagcttttgaccgaattctgggtagcaggatggggatggaagct
gtgatggcattattggagggaacaccagacactcctgcttgtgtagtaactctctctggt
aatcaggctgtgcgtctaccactcatggaatgtgttcaggtgacaaaagatgtgactaga
gccatgcaaaataagaaatttgatgaagccatgaagttgagaggccggagcttccagaac
aactgggatgtatacacacggcttgctcacgtcaaagccccaacgattagccaggttaag
aatgtcgtggctgtgatgaatgtaggagccccagctgcaggtatgaatgcagctgttcgt
tcttctgtaagaatcgggctcatccagggcaaccaagtgctggttgtacatgacggcttc
gaggggctggccaagggtcagattgaggaagtcggctggacctatgttggaggctggact
gggcaaggtggcgctaaacttggaaccaagaggactctgcccaagaagctctttaaggag
atcagtgctaatatcaccaagtttaaaatccagggcctgatcattattgggggctttgag
gcttacacaggcgctctggaattgatggaaggtcgtgcaaaatttgaggagctctgcatc
ccatatgtagtcattcctgctactgtttccaacaatgtccctggctctgacttcagtatt
ggagctgatactgcacttaatgccatctgcatgacttgtgaccgactcaagcagtcagca
gaaggtaccaagcgacgtgtgttcatcattgagaccatgggtggttattgtggctatcta
gctaccatggcggggctagcagctggggctgatgctgcttacatctttgaggagcctttc
aatatacatgacttacaggcaaatgttgaacatctggtgcaaaagatgaagacaacagtg
aagaggggattgattgtaaggaatgagaagtgcaatgaaaattataccactgactttatc
ttcaacctgtactcagaagaggggaaaggcatcttcgacagcaggaagaatgtgctgggc
catatgcaacagggtggaagtccaagtccatttgatagaaactttgctactaagatggga
gccaaggctatgacctggatatcaacaaaaatccaagaaaatgtccgtaatggacgtgtt
tttgccaattcacccgattctgcttgtgtactggggatgcgtaggagagccttgatcttc
caaccattatctgacctcaaagaagaaacagactttgaacacaggatccctagggagcag
tggtggatgaaaatccggcctctcctcaaaatcctggccaaatatgatactgacctggac
actacagatcatgctcacctggaacatatcaagcgcatgtctgtggaatctgcaagcccc
tga

DBGET integrated database retrieval system