KEGG   Sarcophilus harrisii (Tasmanian devil): 100926698Help
Entry
100926698         CDS       T02286                                 

Gene name
THBS1
Definition
thrombospondin 1
Orthology
K16857  
thrombospondin 1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Rap1 signaling pathway
p53 signaling pathway
Phagosome
PI3K-Akt signaling pathway
TGF-beta signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Proteoglycans in cancer
MicroRNAs in cancer
Bladder cancer
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:shr04015]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:shr04350]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:shr04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:shr04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:shr04145]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:shr04115]
Cellular Processes; Cell communication; Focal adhesion [PATH:shr04510]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:shr05206]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:shr05205]
Human Diseases; Cancers; Bladder cancer [PATH:shr05219]
Human Diseases; Infectious diseases; Malaria [PATH:shr05144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 1336 aa AA seqDB search
MSWNARVYRGACRELDLYKGCLDQSEKQTAVSRQVCRVPISTAFHLQRVSAAQADKAVTT
AKMARSTTQPLLQPLHGIKGSSVAEGDPAKLSLFRSLHLRSPSHKLSHSVPGVSFGLLED
LLQPVPALCFPGLRRTSCAWKITQGLRATPTPSLFWVLDTNSSIMGLARWLVLTLLLKVC
GTNRISESGSDNSVFDLFDLPGAANKGSGRRLVKGPDPSSPAYRIEDANLIPSMPEDKFQ
DLVDAIRAERGFIFLASLRQLKKTRGTLLTVEYKDHSGHIFSLVSNGKAGTLDLSMSVQG
KQQVVSVEEALLATGQWKSIILFVQEDRAQLYVGCEKMENAELDAPIESIFTRDLAGSAR
LRVAKGDVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTNQIITLDNPVNGSSPAIRTN
YIGHKTKDLQAICGFSCDELANMFLELKGLRTIVTTLQDSVRKVTEENELLSNVVKKAWS
YPGCSYNGVKYNNNDMWTIDSCTECHCQNSVTMCKKVSCPLMPCSNATIPDGECCPRCWP
SDSADDGWSPWSEWTSCSVTCGNGIQQRGRSCDSLNNRCEGSSVQTRICHIQECDKRFKQ
DGGWSHWSPWSSCSVTCGSGEITRIRLCNSPSPQMNGKPCEGEARETKACQKDACPINGG
WGPWSPWDICSVTCGGGLQKRSRLCNNPKPQFGGKDCVGDATGSQICNKQDCPIDGCLSN
PCFAGAKCTSYPDGSWTCGACPPGYTGNGIQCKDVDECQEVPDACFNHNGVHRCENTDPG
YNCLPCPPRFTGSQPFGRGVEHATANKQVCKPRNPCTDGTHDCNKNAKCNYLGHYSDPMF
RCECKPGYAGNGIICGEDTDLDGWPNEDLVCVANATYHCKKDNCPNLPNSGQEDYDKDGI
GDACDNDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYNHNPDQADTDNNGEG
DACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEHNPDQLDSDSDRIGD
TCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDNDGVPDDRDNCRLVP
NPDQKDSDGDGRGDACKDDFDHDNVPDIDDICPENYDISETDFRRFQMIPLDPKGTSQND
PNWVVRHQGKELVQTVNCDPGLAIGFDEFNAVDFSGTFFINTERDDDYAGFVFGYQSSSR
FYVVMWKQLTQSYWDSTPTIAQGYAGLSVKVVNSTTGPGEHLRNALWHTGNTPGQVRTLW
HDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYDKTYAGGRLGLFVFS
QEMVFFSDLKYECRDS
NT seq 4011 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggaacgccagggtctacagaggtgcttgccgagaattagatctgtacaaaggg
tgcttggaccaaagtgaaaaacaaactgcagtatccaggcaagtctgcagagtccccatt
tctactgcattccaccttcagcgggtcagtgccgcccaggctgacaaagcagttaccaca
gccaagatggcaaggagcacgactcagcctcttcttcagccactgcacgggatcaaggga
agctcagtagctgaaggggaccctgccaagctctcccttttccgatcccttcacctccgg
agcccgtctcacaaactcagccactctgttcccggcgtttcctttggattgcttgaggat
cttctccagccggtacctgctctttgcttcccaggacttcggcgcaccagctgcgcttgg
aagataacccagggactgcgcgctacccctaccccatccctgttttgggtcctggacaca
aacagctccatcatggggctagcccggtggctggtcctcacgctgctgctgaaagtatgt
ggcaccaacaggatctcagagtctgggagtgacaacagtgtgttcgacctctttgatctc
cctggggctgccaacaagggttctggtcgccgtctggtgaaaggtcctgatccttccagt
cctgcttaccgaattgaggatgccaatctgatcccctccatgccagaggacaagtttcaa
gacctggtagatgccattcgagcagaaaggggctttatcttcttggcctccttgaggcag
ttgaaaaagaccaggggcaccctgctgacagtggagtacaaggatcactcgggtcacatc
ttcagtctagtttccaatggcaaagcgggcactctggacctgagcatgtcagttcagggg
aaacagcaagtggtatcagtggaagaagctctcttggccacaggccaatggaagagtatc
atcctgtttgttcaggaggatagggcccagttgtatgtaggctgtgaaaagatggagaat
gccgaattggatgcccccattgaaagtatcttcaccagagacttggctggcagtgccaga
ctccgtgtggctaagggagatgtcaatgataactttcagggggtgctgcaaaatgtgaga
tttgtctttggaaccacaccagaggacatcctaaggaataaaggctgttcaagctctacc
aatcaaatcatcacacttgacaacccagtaaatggttccagccctgccattcgcactaat
tatattggtcacaagaccaaggacctacaggccatctgtggtttctcctgtgatgagttg
gccaatatgttcctagagcttaagggacttcggaccatagtgaccactttgcaagacagc
gtccgtaaggtgactgaagaaaatgaactactgtcaaatgtagtgaagaaggcttggtcg
tatcctggatgcagttataatggagttaaatataataataatgacatgtggactattgat
agttgcacggaatgccattgccagaactcagtgaccatgtgcaaaaaagtgtcctgcccc
ctcatgccctgttccaatgccacaattcctgatggagagtgctgcccacgttgttggccc
agcgattctgcagatgatggctggtctccatggtctgagtggacatcctgttcagtgacc
tgtggcaatgggatccagcagagaggccgttcttgtgacagcctcaacaaccgatgtgaa
ggctcctctgtacagacacgtatttgccacattcaagaatgcgacaagagattcaaacag
gatggaggctggagccactggtctccatggtcatcttgctctgtaacctgtggtagtggt
gagatcaccaggattcgactctgcaactctcctagtcctcagatgaatggaaaaccatgt
gaaggagaagcaagagaaaccaaggcctgtcagaaagatgcttgcccaatcaatggaggc
tggggaccttggtcaccatgggatatctgttctgtcacctgtggaggaggcctgcagaaa
cgtagccggctctgtaataatcccaaaccccaatttggcggcaaggattgcgtgggtgat
gctactggaagccaaatctgtaacaagcaggactgtcctattgatggatgtctgtcaaat
ccttgctttgctggtgcgaagtgtaccagttaccctgatggctcttggacatgtggtgcc
tgtccccctggttacactggaaatggaatccagtgcaaagatgttgatgagtgccaggag
gtccctgatgcctgtttcaaccataatggagtgcacagatgtgagaacactgatcctggc
tataactgcctgccctgtccaccacgttttacaggatctcagccttttggacgtggcgtt
gagcatgctactgctaacaaacaggtatgcaagcctcgcaatccctgcacagatggaact
catgactgcaataagaatgccaaatgcaattacttgggacattacagtgaccccatgttc
cgctgcgagtgcaagccagggtatgctggcaatggcatcatctgcggggaagacactgac
ttggatggttggcccaatgaggaccttgtttgtgtcgccaatgcaacttatcactgcaag
aaagataattgccctaaccttcccaactctggccaggaagactacgataaagatggaatt
ggtgatgcctgtgataatgatgatgacaatgataaaatcccagatgatagggacaactgc
ccattccattataacccagcccaatatgactatgatagagatgatgttggtgaccgctgt
gataactgtccttataaccacaatccagatcaagcagacactgataacaatggagaagga
gatgcctgtgctgcagacattgatggagatggtattcttaatgagagagacaattgccaa
tacgtatataatgttgaccaaagggatactgatatggatggtgttggtgatcagtgtgac
aactgcccactagaacataatccagatcagttggactctgactctgaccgtattggtgat
acatgtgacaacaaccaggatattgatgaagacgggcaccagaataatctcgacaactgc
ccctatgtgcccaatgccaatcaagctgatcacgacaaagatggcaaaggggatgcttgt
gaccacgatgatgacaatgatggtgtgcctgatgacagagacaactgcagactggtgccc
aatcctgaccagaaagattctgatggtgatggacggggggatgcctgcaaagatgacttt
gaccatgacaatgtgccagacattgatgatatctgtccagagaactatgatatcagtgag
actgatttccggcgattccagatgattcctctggatcccaaggggacatcccagaatgat
cccaactgggttgtgcgtcaccagggtaaagagctggtccagactgtgaactgtgatcct
ggccttgctataggctttgatgaatttaatgctgtggacttcagtggtaccttcttcatc
aacacagaaagagacgatgactatgctggctttgtgtttggctaccagtctagcagccgc
ttctatgtcgtgatgtggaaacagctcactcagtcctactgggacagcactcccaccata
gcccagggctacgcaggcctctctgtcaaagtggtcaactccaccacagggccaggggag
cacctgaggaatgctctgtggcacacaggaaacacccccggacaggttcgaaccctttgg
cacgatcctcgtcacattggctggaaagatttcactgcctacagatggcgtcttagccac
agacccaaaactggcttcatcagagtggtgatgtatgaaggaaagaaaatcatggctgat
tcaggtcccatctatgacaagacttatgctggtggaagacttggattatttgtcttctct
caagaaatggtgttcttctccgatcttaaatatgaatgcagagattcctaa

DBGET integrated database retrieval system