KEGG   Sarcophilus harrisii (Tasmanian devil): 100926698Help
Entry
100926698         CDS       T02286                                 

Gene name
THBS1
Definition
(RefSeq) thrombospondin 1
  KO
K16857  
thrombospondin 1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Rap1 signaling pathway
p53 signaling pathway
Phagosome
PI3K-Akt signaling pathway
TGF-beta signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Proteoglycans in cancer
MicroRNAs in cancer
Bladder cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100926698 (THBS1)
   04350 TGF-beta signaling pathway
    100926698 (THBS1)
   04151 PI3K-Akt signaling pathway
    100926698 (THBS1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100926698 (THBS1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100926698 (THBS1)
  Cell growth and death
   04115 p53 signaling pathway
    100926698 (THBS1)
  Cellular community
   04510 Focal adhesion
    100926698 (THBS1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100926698 (THBS1)
   05205 Proteoglycans in cancer
    100926698 (THBS1)
   05219 Bladder cancer
    100926698 (THBS1)
  Infectious diseases
   05144 Malaria
    100926698 (THBS1)
Membrane trafficking [BR:shr04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100926698 (THBS1)
Cell adhesion molecules and their ligands [BR:shr04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     100926698 (THBS1)
Glycosaminoglycan binding proteins [BR:shr00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   100926698 (THBS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 1172 aa AA seqDB search
MGLARWLVLTLLLKVCGTNRISESGSDNSVFDLFDLPGAANKGSGRRLVKGPDPSSPAYR
IEDANLIPSMPEDKFQDLVDAIRAERGFIFLASLRQLKKTRGTLLTVEYKDHSGHIFSLV
SNGKAGTLDLSMSVQGKQQVVSVEEALLATGQWKSIILFVQEDRAQLYVGCEKMENAELD
APIESIFTRDLAGSARLRVAKGDVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTNQII
TLDNPVNGSSPAIRTNYIGHKTKDLQAICGFSCDELANMFLELKGLRTIVTTLQDSVRKV
TEENELLSNVVKKAWSYPGCSYNGVKYNNNDMWTIDSCTECHCQNSVTMCKKVSCPLMPC
SNATIPDGECCPRCWPSDSADDGWSPWSEWTSCSVTCGNGIQQRGRSCDSLNNRCEGSSV
QTRICHIQECDKRFKQDGGWSHWSPWSSCSVTCGSGEITRIRLCNSPSPQMNGKPCEGEA
RETKACQKDACPINGGWGPWSPWDICSVTCGGGLQKRSRLCNNPKPQFGGKDCVGDATGS
QICNKQDCPIDGCLSNPCFAGAKCTSYPDGSWTCGACPPGYTGNGIQCKDVDECQEVPDA
CFNHNGVHRCENTDPGYNCLPCPPRFTGSQPFGRGVEHATANKQVCKPRNPCTDGTHDCN
KNAKCNYLGHYSDPMFRCECKPGYAGNGIICGEDTDLDGWPNEDLVCVANATYHCKKDNC
PNLPNSGQEDYDKDGIGDACDNDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCP
YNHNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPL
EHNPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDD
DNDGVPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDNVPDIDDICPENYDISETDFR
RFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAIGFDEFNAVDFSGTFFINTER
DDDYAGFVFGYQSSSRFYVVMWKQLTQSYWDSTPTIAQGYAGLSVKVVNSTTGPGEHLRN
ALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPI
YDKTYAGGRLGLFVFSQEMVFFSDLKYECRDS
NT seq 3519 nt NT seq  +upstreamnt  +downstreamnt
atggggctagcccggtggctggtcctcacgctgctgctgaaagtatgtggcaccaacagg
atctcagagtctgggagtgacaacagtgtgttcgacctctttgatctccctggggctgcc
aacaagggttctggtcgccgtctggtgaaaggtcctgatccttccagtcctgcttaccga
attgaggatgccaatctgatcccctccatgccagaggacaagtttcaagacctggtagat
gccattcgagcagaaaggggctttatcttcttggcctccttgaggcagttgaaaaagacc
aggggcaccctgctgacagtggagtacaaggatcactcgggtcacatcttcagtctagtt
tccaatggcaaagcgggcactctggacctgagcatgtcagttcaggggaaacagcaagtg
gtatcagtggaagaagctctcttggccacaggccaatggaagagtatcatcctgtttgtt
caggaggatagggcccagttgtatgtaggctgtgaaaagatggagaatgccgaattggat
gcccccattgaaagtatcttcaccagagacttggctggcagtgccagactccgtgtggct
aagggagatgtcaatgataactttcagggggtgctgcaaaatgtgagatttgtctttgga
accacaccagaggacatcctaaggaataaaggctgttcaagctctaccaatcaaatcatc
acacttgacaacccagtaaatggttccagccctgccattcgcactaattatattggtcac
aagaccaaggacctacaggccatctgtggtttctcctgtgatgagttggccaatatgttc
ctagagcttaagggacttcggaccatagtgaccactttgcaagacagcgtccgtaaggtg
actgaagaaaatgaactactgtcaaatgtagtgaagaaggcttggtcgtatcctggatgc
agttataatggagttaaatataataataatgacatgtggactattgatagttgcacggaa
tgccattgccagaactcagtgaccatgtgcaaaaaagtgtcctgccccctcatgccctgt
tccaatgccacaattcctgatggagagtgctgcccacgttgttggcccagcgattctgca
gatgatggctggtctccatggtctgagtggacatcctgttcagtgacctgtggcaatggg
atccagcagagaggccgttcttgtgacagcctcaacaaccgatgtgaaggctcctctgta
cagacacgtatttgccacattcaagaatgcgacaagagattcaaacaggatggaggctgg
agccactggtctccatggtcatcttgctctgtaacctgtggtagtggtgagatcaccagg
attcgactctgcaactctcctagtcctcagatgaatggaaaaccatgtgaaggagaagca
agagaaaccaaggcctgtcagaaagatgcttgcccaatcaatggaggctggggaccttgg
tcaccatgggatatctgttctgtcacctgtggaggaggcctgcagaaacgtagccggctc
tgtaataatcccaaaccccaatttggcggcaaggattgcgtgggtgatgctactggaagc
caaatctgtaacaagcaggactgtcctattgatggatgtctgtcaaatccttgctttgct
ggtgcgaagtgtaccagttaccctgatggctcttggacatgtggtgcctgtccccctggt
tacactggaaatggaatccagtgcaaagatgttgatgagtgccaggaggtccctgatgcc
tgtttcaaccataatggagtgcacagatgtgagaacactgatcctggctataactgcctg
ccctgtccaccacgttttacaggatctcagccttttggacgtggcgttgagcatgctact
gctaacaaacaggtatgcaagcctcgcaatccctgcacagatggaactcatgactgcaat
aagaatgccaaatgcaattacttgggacattacagtgaccccatgttccgctgcgagtgc
aagccagggtatgctggcaatggcatcatctgcggggaagacactgacttggatggttgg
cccaatgaggaccttgtttgtgtcgccaatgcaacttatcactgcaagaaagataattgc
cctaaccttcccaactctggccaggaagactacgataaagatggaattggtgatgcctgt
gataatgatgatgacaatgataaaatcccagatgatagggacaactgcccattccattat
aacccagcccaatatgactatgatagagatgatgttggtgaccgctgtgataactgtcct
tataaccacaatccagatcaagcagacactgataacaatggagaaggagatgcctgtgct
gcagacattgatggagatggtattcttaatgagagagacaattgccaatacgtatataat
gttgaccaaagggatactgatatggatggtgttggtgatcagtgtgacaactgcccacta
gaacataatccagatcagttggactctgactctgaccgtattggtgatacatgtgacaac
aaccaggatattgatgaagacgggcaccagaataatctcgacaactgcccctatgtgccc
aatgccaatcaagctgatcacgacaaagatggcaaaggggatgcttgtgaccacgatgat
gacaatgatggtgtgcctgatgacagagacaactgcagactggtgcccaatcctgaccag
aaagattctgatggtgatggacggggggatgcctgcaaagatgactttgaccatgacaat
gtgccagacattgatgatatctgtccagagaactatgatatcagtgagactgatttccgg
cgattccagatgattcctctggatcccaaggggacatcccagaatgatcccaactgggtt
gtgcgtcaccagggtaaagagctggtccagactgtgaactgtgatcctggccttgctata
ggctttgatgaatttaatgctgtggacttcagtggtaccttcttcatcaacacagaaaga
gacgatgactatgctggctttgtgtttggctaccagtctagcagccgcttctatgtcgtg
atgtggaaacagctcactcagtcctactgggacagcactcccaccatagcccagggctac
gcaggcctctctgtcaaagtggtcaactccaccacagggccaggggagcacctgaggaat
gctctgtggcacacaggaaacacccccggacaggttcgaaccctttggcacgatcctcgt
cacattggctggaaagatttcactgcctacagatggcgtcttagccacagacccaaaact
ggcttcatcagagtggtgatgtatgaaggaaagaaaatcatggctgattcaggtcccatc
tatgacaagacttatgctggtggaagacttggattatttgtcttctctcaagaaatggtg
ttcttctccgatcttaaatatgaatgcagagattcctaa

DBGET integrated database retrieval system