KEGG   Sarcophilus harrisii (Tasmanian devil): 100926708Help
Entry
100926708         CDS       T02286                                 

Gene name
RXRA
Definition
retinoid X receptor, alpha
Orthology
K08524  
retinoid X receptor alpha
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
PPAR signaling pathway
PI3K-Akt signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Bile secretion
Hepatitis C
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100926708 (RXRA)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    100926708 (RXRA)
   03320 PPAR signaling pathway
    100926708 (RXRA)
   04919 Thyroid hormone signaling pathway
    100926708 (RXRA)
  Digestive system
   04976 Bile secretion
    100926708 (RXRA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100926708 (RXRA)
   05202 Transcriptional misregulation in cancers
    100926708 (RXRA)
   05216 Thyroid cancer
    100926708 (RXRA)
   05222 Small cell lung cancer
    100926708 (RXRA)
   05223 Non-small cell lung cancer
    100926708 (RXRA)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100926708 (RXRA)
  Infectious diseases
   05160 Hepatitis C
    100926708 (RXRA)
Transcription factors [BR:shr03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100926708 (RXRA)
Nuclear receptors [BR:shr03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100926708 (RXRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 468 aa AA seqDB search
MLLDYNCGLLDFSTQVNSTSLNSPTGRGSMAAPSLHPSIGPGLGSSLGSSSQLHSPISTL
SSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFGTGSPQLNSPMNPVSSTEDIKPPLGLN
GVLKVPAHPSGTMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDN
KDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVEK
ILEAELAVEPKTETYIEANMGLNPNSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPL
DDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELV
SKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPDQPGR
FAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgcttctagattataactgtgggctgttggatttttccacccaggtcaattccacatcc
ctgaattcccccactggcagagggtccatggctgccccctccctgcacccgtccattggc
cccggccttggctcgtccctcggatcatccagccagctgcactcccccatcagcactctg
agctcccccattaatggcatgggccctcccttctctgtcatcagctcccccatggggcct
cactcaatgtctgttcccacaacccccacccttgggtttgggaccggcagcccccagctc
aactcgccaatgaaccctgtcagcagcacagaagatattaagccacctcttgggctcaat
ggagttcttaaagtgcccgcccatccctcaggaaccatggcctccttcaccaagcacata
tgtgccatctgtggggaccgctcctcaggtaaacattatggtgtgtacagttgtgaaggc
tgcaaaggcttcttcaagagaacggtccgcaaggacctcacctacacctgccgagataat
aaggactgcctgattgacaaacgccagaggaaccggtgccaatactgccgctaccagaag
tgtcttgccatgggcatgaagcgagaagctgtgcaagaagagaggcagaggggcaaagac
cggaatgagaacgaggtggaatcaaccagtagtgctaatgaggacatgccagtggaaaag
atcttggaagctgaactcgctgtggagccaaagacagagacgtacattgaggcaaacatg
ggactgaatcccaattcgcccaacgaccccgttaccaacatttgccaagcagcagacaaa
cagctcttcaccttggtggaatgggccaagagaatcccccacttctcagaactacccctg
gatgaccaggtcattctattgcgagcgggctggaatgaactgctcatcgcctcgttctct
caccgctcgatagcagtgaaagatgggatccttcttgccaccggcctccacgtccatagg
aacagcgctcacagtgcaggggtgggcgccatctttgacagagtcctgacagaacttgtg
tcaaaaatgcgagacatgcagatggacaagacagagctgggctgcctgagagccattgtc
ctcttcaaccctgactctaaaggactttccaaccctgcggaagtagaagccctacgagag
aaagtttacgcttccctcgaagcctactgcaaacacaagtatccggaccagcctgggagg
ttcgccaagctcttgctccgtctccccgctctccggtccatcggtctgaaatgcttggag
cacctcttcttcttcaagctaataggagatacccccattgacaccttcctgatggagatg
ttggaggcaccccaccaaatgacatag

DBGET integrated database retrieval system