KEGG   Sarcophilus harrisii (Tasmanian devil): 100926822Help
Entry
100926822         CDS       T02286                                 

Gene name
USP48
Definition
ubiquitin specific peptidase 48
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 978 aa AA seqDB search
MRRNCKGNPNCLVGIGEHVWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGATCYVNTF
LQVWFLNLELRQALYLCPSTCGDHMMGDGIQEERDYEPQTICEHLQYLFALLQNSNRRYI
DPSGFVKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYVTVC
NQCGRESKLLSKFYELELNIQGHKQLTDCITEFLKEEKLEGDNRYFCENCQSKQNATRKI
RLLSLPCTLNLQLMRFVFDRQTGHKKKLNTYIGFSELLDMEPYMEHKEGIYVYELSAVLI
HRGVSAYSGHYIAHVKDPQTGEWYKFNDEEIEKMEGKKLQLGIEEDLAEPSKSQTRKPKC
GKGTHCSRNAYMLVYRLQTQEKSSLTVQVPAFLQELVERDNSKFEEWCVEMAEMRKQSVD
KGKAKHEEVKELYQRLPAGAEPYEFVSLEWLQKWLDESTPTKPIDNHACLCAHDKLHPDK
ISIMKRISEYAADIFYSRYGGGPRLNVKALCKDCVVERCRVLRLKNQLNEDYKIVTNLLK
TTVKGNEGFWVGKSSLRSWRQLALEQLDEQDIDTDQSNGKMNGDTLNKDDSKDEKKDEEE
ELNFNEDILCPHGSLCITENERRLVSKEAWGKLLQYFPKAPEFPSYKECCSQCKILEREG
EENEALHKMIANEQKTSLPNLFQDKSRPCLSNWPQETDVLYIVSQFFVEEWRKFVRRPTR
CSPVSSVGNSALLCPHGGLMFTFASMTKEDSKLIALIWPNEWEMIQKLFVVDHVIKIIKG
ETDDANPSQMLYTSEPSLCPECREGLLCQQQRDLREYTQATIYVHKVVDNKKVMKDAAPE
LNVSSSETEEDREETRPEGEKDPDFNQTNGGTKRQKISHQNYIVYQKQVIRRSMRHRKVR
GEKALLVSANQTLKELKIQIMHAFSVAPFDQNLSIDGKILNDDTATLGTLGVIPESVILL
KKVCMPEEGFKGTGLLGH
NT seq 2937 nt NT seq  +upstreamnt  +downstreamnt
atgagaagaaattgcaaagggaatccgaattgcttggttggcatcggagaacacgtctgg
ttaggggaaattgatgaaaacagctttcacaacattgatgatcccaactgtgaaaggagg
aaaaagaactcatttgtgggtctaacaaaccttggagcaacgtgctatgtgaacactttt
cttcaggtttggtttcttaacctggagcttagacaggctctgtatttatgtccaagtacc
tgtggtgaccacatgatgggagatggcatacaggaagagagagattatgaacctcagacc
atttgtgaacatctccagtacctttttgctttgctgcagaacagtaacagacggtacatt
gatccatctggatttgttaaagccttaggcttggacacaggacaacagcaggatgcacaa
gaattttcaaagctgtttatgtctttactggaggatactttgtctaagcagaagaatcca
gatgtaaggaatatcgtccaacagcaattttgtggagaatatgcatatgtgactgtctgt
aaccagtgtggccgtgaatctaagcttttatcaaaattttatgaactggagttaaatatc
caagggcacaagcagctaacagattgcatcaccgaatttctcaaggaagaaaaattagaa
ggagacaatcgatacttttgtgaaaactgtcagagtaaacagaatgcaacaagaaagatc
cgactgctcagtcttccttgtacacttaatttacagctaatgcgttttgtatttgacaga
caaacaggacataagaaaaagctgaatacctacattggcttctcagaacttttggatatg
gaaccttacatggagcataaagaaggaatctatgtttatgaactgagtgctgtcctcata
caccgaggtgtaagtgcatattctggtcactacattgctcacgtgaaggatcctcagact
ggagaatggtacaaattcaatgatgaagaaatagaaaagatggagggaaagaaattacag
ctagggattgaggaagatctagcagagccttctaagtcacagacacgtaaacctaagtgt
gggaaaggaactcactgctctagaaatgcctacatgttggtgtatagattacagacacaa
gagaaatcttctctgacagttcaagtaccagcttttcttcaagagctggtagagcgtgat
aactccaagtttgaggagtggtgtgtggaaatggctgaaatgcgtaaacaaagtgtggac
aaaggcaaagccaaacacgaagaggtgaaggaactctaccaaaggttacctgctggagct
gagccatatgaatttgtctctcttgagtggctgcagaaatggttagatgaatctacccca
acaaagcccattgataaccatgcctgcttgtgtgcccatgacaaactgcatcctgacaaa
atctccatcatgaagagaatttctgaatatgcagcagatattttctacagtcgctatgga
gggggaccccggcttaatgttaaagccctttgcaaagactgtgtggtagagcgctgtcgt
gtattgcggttgaagaaccaactaaatgaagattataaaattgttacaaatttgttgaaa
accacagtgaagggtaatgaaggcttctgggtagggaagtcttccttacgaagttggaga
cagctagcccttgagcagttagacgagcaagatattgatacagaccaaagtaatgggaaa
atgaatggtgacaccttaaataaagatgattccaaggatgagaaaaaagatgaggaagag
gagttaaattttaatgaagacatcctgtgtccgcacggtagtttatgtataacagaaaat
gagagacgtcttgtttctaaagaggcttggggaaaactgctgcaatactttccaaaagct
ccagaatttccaagttacaaagaatgctgttctcaatgcaagatcctggaaagagaagga
gaagaaaatgaagccttacacaagatgattgcaaatgagcaaaaaacttctctcccgaat
ttgttccaagacaaaagcagaccctgtcttagtaattggcctcaggaaacggatgtgctt
tacattgtatctcaattttttgtagaagaatggcggaaatttgtgaggcggcctactaga
tgtagtcctgtatcatcagtaggaaacagtgctcttctctgtcctcatggtggacttatg
tttacttttgcttccatgaccaaagaagattctaaacttatagctctcatatggcccaac
gagtgggagatgatacaaaagctatttgtcgtggatcatgtaattaaaattatcaaaggt
gaaacggatgatgcaaatccttcacagatgttatatacgtcagaacccagtctttgtcca
gaatgcagggaaggtttattgtgtcaacagcagagggatcttcgggagtacacccaagcc
actatatatgtacataaagttgtggataataaaaaggtaatgaaggatgctgctccagaa
ttgaatgttagtagttcagaaactgaagaggacagggaagaaacaaggcccgaaggggaa
aaagacccagactttaatcagaccaatggtggaacaaagcggcaaaaaatttctcatcag
aattatattgtttatcagaagcaagtcattcgacggagcatgcggcaccgtaaagttcgg
ggagaaaaggcactacttgtttcagcaaatcaaacattaaaagaactaaaaatccagatc
atgcacgccttctcagtagctccttttgaccagaacctttcaatagatgggaaaatccta
aatgatgacactgcaacccttggtactcttggtgtcattcctgaatccgttattttgtta
aagaaagtgtgtatgcctgaagaaggatttaaagggactggtctccttggacattaa

DBGET integrated database retrieval system