KEGG   Sarcophilus harrisii (Tasmanian devil): 100926823Help
Entry
100926823         CDS       T02286                                 

Gene name
RPA2
Definition
(RefSeq) replication protein A 32 kDa subunit
  KO
K10739  replication factor A2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr03030  DNA replication
shr03420  Nucleotide excision repair
shr03430  Mismatch repair
shr03440  Homologous recombination
shr03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100926823 (RPA2)
   03420 Nucleotide excision repair
    100926823 (RPA2)
   03430 Mismatch repair
    100926823 (RPA2)
   03440 Homologous recombination
    100926823 (RPA2)
   03460 Fanconi anemia pathway
    100926823 (RPA2)
DNA replication proteins [BR:shr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    100926823 (RPA2)
DNA repair and recombination proteins [BR:shr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     100926823 (RPA2)
   MMR (mismatch exicision repair)
     100926823 (RPA2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     100926823 (RPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C tRNA_anti-codon
Motif
Other DBs
NCBI-GeneID: 100926823
NCBI-ProteinID: XP_003765037
Ensembl: ENSSHAG00000015255
Position
3
AA seq 275 aa AA seqDB search
MWNSGFDGSYGNTSYGGGGYSQAPGGFGTPTASQAEKKSRARAQHIVPCTISQLLSANLI
DEVFKIGEIEISQVTIVGIIRQAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVV
PPETYVKVAGHLRSFQNKKSLVAFKILPLEDMNEFTIHILETVNAHMILSQSISQPLAGR
PSLHTSGIGDAGNFGGNSFGGNSLMPANGLTVTQNQVLNLIKACPRPEGMNFQDLKSQLH
NLNVSVIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatagtggctttgatggaagctacgggaacacgtcatacggaggtggaggctac
tcacaggccccaggaggctttggcactcccactgcttctcaggctgaaaagaaatcaaga
gcacgagcccaacacattgttccttgcaccatatcacagctcctgtctgccaacctgatt
gatgaagtatttaagattggagaaattgagatttcacaggtcactattgtgggaataatc
cgacaagcagagaaagcacccacgaacattgtttacaaaatagatgatatgactgctgcg
ccgatggatgtcagacaatgggtagacactgatgacacaagcagcgagaatactgtggta
ccaccagaaacctatgtgaaagtggctggtcatctcaggtctttccagaacaaaaagagc
ctggtagcatttaagattcttcctctagaggacatgaatgagtttaccatccatatcctg
gaaactgtcaatgctcatatgatcctaagccaatccatcagtcagcccttggcaggaaga
ccttctctccacacttctggaataggtgatgcaggaaacttcggaggaaacagctttggg
gggaacagtctgatgccagcaaatggcctcactgttacccagaaccaggtgctgaatttg
attaaagcttgtcccaggccagaaggcatgaacttccaggatctcaagtctcagctacac
aacttaaatgtgtctgtgatcaagcaagctgttgactttctcagcaatgagggacacatc
tattccactgtggatgatgaccacttcaaatccacagatgcggaataa

DBGET integrated database retrieval system