KEGG   Sarcophilus harrisii (Tasmanian devil): 100926823Help
Entry
100926823         CDS       T02286                                 

Gene name
RPA2
Definition
replication protein A2, 32kDa
Orthology
K10739  
replication factor A2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100926823 (RPA2)
   03420 Nucleotide excision repair
    100926823 (RPA2)
   03430 Mismatch repair
    100926823 (RPA2)
   03440 Homologous recombination
    100926823 (RPA2)
   03460 Fanconi anemia pathway
    100926823 (RPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 275 aa AA seqDB search
MWNSGFDGSYGNTSYGGGGYSQAPGGFGTPTASQAEKKSRARAQHIVPCTISQLLSANLI
DEVFKIGEIEISQVTIVGIIRQAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVV
PPETYVKVAGHLRSFQNKKSLVAFKILPLEDMNEFTIHILETVNAHMILSQSISQPLAGR
PSLHTSGIGDAGNFGGNSFGGNSLMPANGLTVTQNQVLNLIKACPRPEGMNFQDLKSQLH
NLNVSVIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatagtggctttgatggaagctacgggaacacgtcatacggaggtggaggctac
tcacaggccccaggaggctttggcactcccactgcttctcaggctgaaaagaaatcaaga
gcacgagcccaacacattgttccttgcaccatatcacagctcctgtctgccaacctgatt
gatgaagtatttaagattggagaaattgagatttcacaggtcactattgtgggaataatc
cgacaagcagagaaagcacccacgaacattgtttacaaaatagatgatatgactgctgcg
ccgatggatgtcagacaatgggtagacactgatgacacaagcagcgagaatactgtggta
ccaccagaaacctatgtgaaagtggctggtcatctcaggtctttccagaacaaaaagagc
ctggtagcatttaagattcttcctctagaggacatgaatgagtttaccatccatatcctg
gaaactgtcaatgctcatatgatcctaagccaatccatcagtcagcccttggcaggaaga
ccttctctccacacttctggaataggtgatgcaggaaacttcggaggaaacagctttggg
gggaacagtctgatgccagcaaatggcctcactgttacccagaaccaggtgctgaatttg
attaaagcttgtcccaggccagaaggcatgaacttccaggatctcaagtctcagctacac
aacttaaatgtgtctgtgatcaagcaagctgttgactttctcagcaatgagggacacatc
tattccactgtggatgatgaccacttcaaatccacagatgcggaataa

DBGET integrated database retrieval system