KEGG   Sarcophilus harrisii (Tasmanian devil): 100926834Help
Entry
100926834         CDS       T02286                                 

Definition
histone H2B type 2-E-like
Orthology
K11252  
histone H2B
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:shr00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100926834
  Immune diseases
   05322 Systemic lupus erythematosus
    100926834
  Substance dependence
   05034 Alcoholism
    100926834
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100926834
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaacccgccaagtccgctcctgccccgaagaagggttccaagaaggccgtcacc
aaggcgcagaagaaagacggcaagaagcgcaagcgcagccgcaaggaaagctactccatc
tacgtgtacaaggtgctgaagcaggtgcaccccgacacgggcatctcctccaaagccatg
ggcatcatgaactctttcgtcaacgatatcttcgagcgcatcgccggcgaggcgtcccgc
ctggcgcattacaacaaacgctccaccatcacgtcccgggagatccagacggccgtgcgt
ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagctccaagtaa

DBGET integrated database retrieval system