KEGG   Sarcophilus harrisii (Tasmanian devil): 100926877Help
Entry
100926877         CDS       T02286                                 

Gene name
ADRA2B
Definition
adrenoceptor alpha 2B
Orthology
K04139  
adrenergic receptor alpha-2B
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:shr04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 438 aa AA seqDB search
MDSPEPYSVQATAAIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL
VATLIIPFSLANELLGYWYFRHTWCEVYLALDVLFCTSSIVHLCAISLDRYWSVSRALEY
NSKRTPRRIKGIILTVWLIAAFISLPPLIYKGDKDKKPGGRPQCKLNEEAWYILSSSIGS
FFAPCLIMILVYLRIYLIAKRRNRQGPHGKRAPGDGDTGPSGPGGASAISKLPPSVLPAV
GEANGHSKPPGEREGGEPIGDPTPPSTPPNQSSVGPEDGNHRREEEEEEEEEEEEEECGP
PALPTSSSPQGTSNFQPPQGSQILATLRGQVLLARQPASLGLQPWRRRTQMNREKRFTFV
LAVVIGVFVLCWFPFFFSYSLGAICPQHCKVPHGLFQFFFWIGYCNSSLNPVIYTIFNQD
FRRAFRRILCRQWTQTAW
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggatagcccagagccctactctgtgcaggccacggcagccattgcagctgtcatcacc
tttctcatccttttcactatctttggcaatgccctagtcatcctggccgtgttgactagc
cgctctcttcgagccccacagaacttgttcctggtttccctggctgcagccgacatcttg
gtggccaccctcatcatacccttctccctggccaatgaactgctgggatactggtacttc
cgacacacctggtgtgaggtctacctggccttggatgtccttttctgtacctcctccatc
gtgcacctgtgtgccatcagtctggaccgctactggtcagtgagccgggccctggagtac
aactccaagaggaccccccgccggattaagggcatcattctcactgtctggctcattgcc
gcctttatctcactgccccccctcatctacaagggtgacaaggacaagaaacctggaggc
cgaccccagtgtaagcttaacgaggaggcttggtacatcctgtcctccagcattggttcc
ttctttgcaccctgcctcatcatgatcctggtctacttgcggatctacctgattgccaag
cgccgtaaccgccaggggccccatggcaaacgggcccctggggatggggacactgggccc
tctggtcctggtggggcatctgcgatatccaagctgccaccctctgttctcccagctgtg
ggtgaagccaatgggcattccaagcctcccggggagagagagggaggggaaccgatcgga
gatccaacgccaccttctacgcctcccaaccagagctccgtggggccggaggatggcaat
cacaggcgggaggaggaggaggaggaggaagaagaggaagaggaagaagagtgtgggcct
ccagcccttccaacttcctcctctccccaaggaacctcaaactttcaacctccccagggc
tcccagatactggctacactccggggccaggtactcttggcccgccaacctgcttctctg
gggctgcagccatggagacgaaggacccagatgaaccgagaaaaacgcttcacctttgtg
ctggccgtagtgatcggagtcttcgtcctctgctggtttcctttcttcttcagttatagc
ctaggagccatctgcccccagcattgcaaggtccctcatggcctttttcagtttttcttc
tggattggttattgcaacagttccctcaaccctgtcatctatacaattttcaaccaggat
ttccgcagggccttccgtaggatcctttgccgccaatggactcagacagcttggtga

DBGET integrated database retrieval system