KEGG   Sarcophilus harrisii (Tasmanian devil): 100926936Help
Entry
100926936         CDS       T02286                                 

Gene name
PDIA4
Definition
protein disulfide isomerase family A, member 4
Orthology
K09582  
protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Protein processing in endoplasmic reticulum
Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100926936 (PDIA4)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    100926936 (PDIA4)
Enzymes [BR:shr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100926936 (PDIA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 644 aa AA seqDB search
MRLRKPCLLVLLLGLAQLLVLASAHEMEEDSFSKDDAVDEEEEEEEEEDYDEDDSEVKED
NGVLVLNDNNFDAFVAGKDTVLLEFYAPWCGHCKQFAPVYEKIAKTLQENDPPIPVAKID
ATAASTLASRYDVSGYPTIKILKRGQAVDYDGSRSEDDIVAKVKEVSQPSWTPPPEVTLV
LTKDNFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDAIEET
DLAKRFDVTGYPTLKIFRKGKAFDYNGPREKYGIVDYMIEQSEPPSKEILAVKQVQEFLK
EGNDVIVIGIFKSADDQAYQLYQETVNNMREDYKFHHTFNNEVAKFLKVSSGKLVVMQPE
KFHSKYEQKINVLDIKESTESAAIRDHVVKHAVPLVGHRTTSNDAKRYAKRPLVVVYYTV
DFSFDYRVATQYWRNKILEVAKDFPEYTFAIADEDDYSSEVKDLGLSDSGEEINVAILAE
GGKKYAMEPEEFDSDTLRDFVVAFKKGKLKAIIKSQPVPKNNKGPVTIVVGKTFDSIVMD
SKSDVLVEFYAPWCGHCKQLEPVYTELGKKYKHRKNLIIAKMDATANDVTNDHYKVEGFP
TIYFAPRTDKNNPIKFENEKRDLEHLSAFIEDHSTKLSRTKEEL
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgaggctccgcaaaccctgcctactggtccttctcttggggctggcccagctgctggtg
ctggcgagcgcccatgaaatggaagaggattcttttagtaaagatgatgctgttgatgag
gaagaggaggaggaggaggaggaggattatgatgaagatgattctgaagtgaaagaagac
aatggtgtcctagtcctgaatgacaacaactttgatgcctttgtggctggcaaagatact
gtgctgctggaattctatgctccctggtgtggtcactgtaaacaatttgctccagtgtat
gagaaaatagctaagacccttcaagaaaatgatcctcctatccctgttgccaaaattgat
gcaacagcagcatctacattagcaagccggtatgatgtaagcggctatcccaccattaaa
atcctaaaaagggggcaagcagtggattatgatggctcaagatcagaagatgacattgtt
gctaaagtcaaagaagtttcccaacccagctggactcctccacctgaagtgaccctggtg
ctcactaaagataacttcgatgaagtagtgaatgatgcagacatcattttggtggagttc
tatgctccttggtgtggacactgtaagaaacttgctccagaatatgagaaagctgcaaaa
gaacttagtaagcgttctccacccattcccttggctaaagtagatgccattgaagaaact
gatctggccaagaggttcgatgtcactggatacccaactctgaaaatcttccggaagggg
aaagcttttgactacaatggcccacgagagaaatacggtattgtggactacatgattgaa
caatctgaacctccatccaaagaaattttggctgtgaaacaagtccaggaattcctgaag
gagggaaacgatgtcatcgttatcggcatcttcaaaagcgctgatgaccaagcttaccag
ctgtatcaggaaactgtgaacaacatgagggaagattacaaatttcaccatactttcaac
aatgaagttgcaaaattcctgaaagtctcttctgggaagttggttgtgatgcagccagaa
aaatttcattctaagtatgaacaaaaaatcaatgttttagacattaaggaatccactgaa
agtgctgccatcagggaccacgtggtaaagcatgctgtgccattggttggtcatcgaaca
acttccaacgatgccaagagatatgctaaacgtcctctggtggttgtctattacactgtg
gacttcagttttgactatagagttgcgactcagtattggagaaacaagatcttggaagtt
gctaaggatttccctgaatatacctttgccattgctgatgaggacgactactcttctgaa
gtgaaggacttgggactgagcgacagtggtgaagagatcaatgtagctatcctagctgag
ggtggcaagaaatatgccatggaaccagaggaatttgattctgatactctccgagacttt
gtggtagcattcaaaaaaggaaaactaaaggcaatcatcaaatcccagcctgtgcccaaa
aacaacaaagggcctgtaacaattgtggtaggtaagacatttgactctatagtgatggac
tcaaagtcagatgtcctcgttgagttctatgccccatggtgtggacactgtaagcagcta
gaacctgtgtacaccgaactggggaagaagtacaagcatcggaagaacctgatcatagcg
aagatggatgccaccgccaacgatgtgaccaatgaccactacaaggtggaaggatttcct
actatctactttgctcctcgcactgacaaaaataaccctattaaatttgaaaatgagaag
agagatttggagcacttgagtgcatttatagaagatcacagtacaaaactgagcaggacc
aaagaagaactttaa

DBGET integrated database retrieval system