KEGG   Sarcophilus harrisii (Tasmanian devil): 100926982Help
Entry
100926982         CDS       T02286                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase isoform X2
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00561  Glycerolipid metabolism
shr01100  Metabolic pathways
shr04714  Thermogenesis
shr04723  Retrograde endocannabinoid signaling
shr04923  Regulation of lipolysis in adipocytes
Module
shr_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100926982 (MGLL)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100926982 (MGLL)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    100926982 (MGLL)
  Environmental adaptation
   04714 Thermogenesis
    100926982 (MGLL)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100926982 (MGLL)
Peptidases [BR:shr01002]
 Serine Peptidases
  Family S33
   100926982 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Lipase_3 Abhydrolase_3 DLH Thioesterase Peptidase_S9 Abhydrolase_2 BAAT_C PGAP1 Abhydrolase_5 LIDHydrolase FSH1 Ser_hydrolase
Motif
Other DBs
NCBI-GeneID: 100926982
NCBI-ProteinID: XP_012399142
Position
2
AA seq 303 aa AA seqDB search
MPEESSPRRTPQNVPYESLPHLVNADGQYLFCRYWKPKEMPRALVFICHGAGEHCGRYDD
LAQMLNELGLLVFAHDHVGHGQSEGERMIVSDFHVFVRDVFQHVDLMQKDHPGLPVFLLG
HSMGGAISILTASERPNSFSGMVLISPLVVASPESATTFKVLAAKVLNLVLPNLSLGSID
SNVISRNKTEVDSYNSDPLICRTGLKVCFGIQLLNAVSRVERALPRLTLPILLLQGSADK
LCDSKGAYVLMEAAKSQDKTLKIYEGAYHVLHKELPEVTSSVFHEIKMWFSQRIATGGAT
ANP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggaaagttctcctaggcggacaccccagaatgtcccttatgagagccttccc
cacctggtcaatgcagatgggcagtatctcttctgcagatattggaagcccaaagagatg
ccaagggctctcgtgtttatctgtcatggtgctggtgaacactgtggccgctacgatgac
ttggcccagatgctgaatgaacttggcttgttggtgtttgctcatgaccatgttggccat
ggacagagtgaaggtgaaaggatgatcgtgtctgatttccatgttttcgtcagggatgtg
ttccagcatgtagatctcatgcaaaaagatcatcctgggcttcctgtctttcttctgggg
cattccatgggaggagccatttccatcctaactgcttccgagagaccaaatagtttttct
ggcatggttttaatttcacctttggtggtcgccagcccagaatcagcaacaactttcaag
gtcctcgctgcgaaagttctcaaccttgttctccccaacctgtccctggggtccatcgac
tccaatgtgatttcccgaaataagaccgaggtcgattcctacaactcagatcccctgatc
tgccggacggggctgaaggtctgctttggcatccagctgctgaacgccgtgtcccgggtg
gagagggccctgcccagactgacactgccaattctgctgctgcaggggtctgccgacaag
ctgtgtgacagcaagggggcctacgtgctaatggaagctgccaaaagtcaggataagacc
ctgaagatatatgaaggtgcctaccacgtcctccacaaagaactccccgaagtgacaagc
tctgtcttccatgaaataaaaatgtggttctctcaaaggatagctacaggaggagccact
gccaatccctaa

DBGET integrated database retrieval system