KEGG   Sarcophilus harrisii (Tasmanian devil): 100927091Help
Entry
100927091         CDS       T02286                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00480  Glutathione metabolism
shr00980  Metabolism of xenobiotics by cytochrome P450
shr00982  Drug metabolism - cytochrome P450
shr00983  Drug metabolism - other enzymes
shr01524  Platinum drug resistance
shr05200  Pathways in cancer
shr05204  Chemical carcinogenesis
shr05225  Hepatocellular carcinoma
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100927091
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100927091
   00982 Drug metabolism - cytochrome P450
    100927091
   00983 Drug metabolism - other enzymes
    100927091
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100927091
   05204 Chemical carcinogenesis
    100927091
   05225 Hepatocellular carcinoma
    100927091
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100927091
  Drug resistance
   01524 Platinum drug resistance
    100927091
Enzymes [BR:shr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100927091
Transporters [BR:shr02000]
 Other Transporters
  Pores ion channels [TC:1]
   100927091
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C_3 GST_C GST_N_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 100927091
NCBI-ProteinID: XP_003769201
Ensembl: ENSSHAG00000015358
Position
4
AA seq 220 aa AA seqDB search
MASKPILHYVNGRGRMESIRWLLAVAGVEFEEKFFETREQLQKLKETVLLFQQVPMVEID
GMKLVQTRAILHYIAEKYNLLGKDMKERAHIIMYSEGTMDLMELIMIYPFLKGEESKQRL
VEIANKAKGRYFPAFENILKAHGQNFLVGNQLSMADVQLFEAILMVEEKVPDALTGFPLL
QAFKTRISNIPTVKTFLAPGSKRKPMPDAKYVEDIIKIFF
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtaaacccatcctccactatgttaatggaagaggcagaatggaatccatccga
tggctcctagcagtagctggagtagagtttgaagaaaaattttttgaaacaagagaacaa
ttgcaaaagttgaaagaaactgtactcctgttccaacaagtgccaatggtggaaattgat
gggatgaaactggttcagacaagagctattctccactacattgctgagaaatataatcta
cttgggaaggacatgaaggagagagcacatattatcatgtattcagagggaacaatggat
ctgatggaactaatcatgatctaccctttcctgaaaggagaagagtccaaacaaagactc
gttgaaattgctaataaggctaaaggcagatactttcctgcttttgaaaatattttgaag
gctcatggacaaaattttcttgttggtaaccagctgagcatggcagatgtacaactgttt
gaagctattttaatggtagaagaaaaagtccctgatgcactcactggatttcctttactc
caggcattcaaaactcgaatcagtaatattccaacagttaagacattcctggcccctggc
agcaagagaaagcctatgcctgatgctaagtatgtggaagatattatcaagatctttttt
taa

DBGET integrated database retrieval system