KEGG   Sarcophilus harrisii (Tasmanian devil): 100927245Help
Entry
100927245         CDS       T02286                                 

Gene name
DYRK1A
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A
Orthology
K08825  
dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100927245 (DYRK1A)
Protein kinases [BR:shr01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100927245 (DYRK1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 789 aa AA seqDB search
MQSKVKVFGFGKEKTSIWSGFEEKREKIGGETSACKPSSVRLAPSFSFHAAGLQMAGQMP
HSHQQYSDRRQPNISDQQVSALSYTDQIQQPLTNQVIPDIVMLQRRMPQTFRDPATAPLR
KLSVDLIKTYKHINEVYYAKKKRRHQQGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEK
WMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHD
TEMKYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALL
FLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLL
GMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIAPAHILDQAPKARKF
FEKLPDGTWNLKKTKDGKREYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKD
LILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNSVSTSPAMEQSQSSGTTSSTSSS
SGGSSGTSNSGRARSDPTHQHRHSGGHFTAAVQAMDCETHSPQVRQQFPAPLGWSGTEAP
TQVTVETHPVQETAFHVAPQQNALHHHHGNSSHHHHHHHHHHHHHGQQALGNRTRPRVYN
SPTNSSSTQDSMEVGHSHHSMTSLSSSTTSSSTSSSSTGNQGNQAYQNRPVVANTLDFGQ
NGAMDVNLTVYSNPRQETGITGHPAYQFSANTGPTHYMTEGHLAMRQGIDREESPMTGVC
VQQSPVASS
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgcagtccaaggtaaaggtgtttggctttggtaaggagaagacatctatatggtcaggg
tttgaagaaaagcgggagaaaattggaggagagacttcagcatgcaaaccttcatctgtt
cgccttgcaccatcattttcattccatgccgctggtcttcagatggctggacaaatgccc
cattcacatcagcagtacagtgaccgtcgtcagccaaacataagtgaccaacaggtttct
gccttatcttacactgaccagattcaacagcctctaactaaccaggtgatacctgatatt
gtcatgttacagagacggatgccccaaaccttccgtgatccagcaactgctcctttgagg
aaactctctgttgacttgatcaaaacatacaaacatattaatgaggtttactatgcaaaa
aagaagcgaagacatcaacagggccaaggagatgattctagtcataagaaggagcggaaa
gtttacaatgatggctacgatgatgataactatgattatattgtaaaaaatggggaaaaa
tggatggatcgttatgaaattgactctttaataggaaagggttcctttggacaggttgta
aaggcatatgatcgtgtggagcaggagtgggttgccattaaaattattaagaacaagaag
gcttttttaaatcaagcccaaattgaagtgcgacttcttgagcttatgaacaaacatgac
actgaaatgaaatattacatagtgcatttgaaacgccactttatgttccgaaaccatctc
tgcttagtttttgaaatgttgtcttataatctttatgacttgttaagaaacacaaatttt
cgaggtgtctctttgaacctaacacgaaaatttgcacaacagatgtgcactgcactgctt
ttccttgcaactccagaacttagtatcattcactgtgacctcaaacctgagaatattctt
ctctgtaaccctaaacgcagcgctatcaagattgttgactttggaagttcttgtcaactg
ggacagaggatataccagtatatccagagtcgcttttatcgctctccagaggtactactg
ggaatgccttatgatcttgctattgacatgtggtcccttgggtgtattttagttgaaatg
cacactggagaacctcttttcagtggagccaatgaggtggatcagatgaataaaatagtg
gaagttctaggaatagcacctgcacatattcttgaccaagcacccaaagcaagaaagttc
tttgagaagttgccagatggcacttggaacttaaagaagaccaaagatggaaaaagggag
tataaaccaccaggaacccgcaaacttcataatattcttggagtagaaacaggaggacct
gggggacgtcgtgctggggaatctggacatactgtagcggactacttgaagttcaaagac
ctcatcttaaggatgctcgattatgaccctaagactagaattcaaccatattatgccctg
cagcatagcttttttaagaaaacagcagatgaaggtacaaatacaagtaacagtgtctct
acaagtcctgctatggagcagtcacagtcttcaggaaccacctctagtacatcttcaagc
tcaggtggatcttcagggacaagcaacagtggaagggctcggtcagatccaacacatcag
catcgacatagtggtggtcactttacagctgctgtccaagcaatggattgtgaaacacac
agtcctcaggtgcgccagcaatttccagctcctcttggttggtcaggcactgaagcgcct
acacaagtcactgttgaaactcatccagttcaagaaacagcgttccatgtagcccctcaa
cagaatgcattacatcatcatcatggaaacagctcccatcatcatcaccaccaccaccac
catcaccatcatcatggacaacaagccttgggtaaccggaccaggccaagggtctacaat
tctccaacaaacagctcctccacccaagattctatggaagttggccatagtcaccactcc
atgacatccctgtcttcctcaactacttcttcctctacatcttcctcctctactggtaac
caaggtaatcaagcctaccagaatcgcccagtggttgctaataccttggactttggacag
aatggagccatggatgttaatttaacagtctactccaatccccgccaggagactggtata
actggacatccagcataccaattttctgccaatacaggtcctacacattacatgactgaa
ggacatctggctatgaggcaaggaattgatagagaagaatctcctatgacgggagtttgt
gttcaacaaagtcctgtggctagctcgtga

DBGET integrated database retrieval system