KEGG   Sarcophilus harrisii (Tasmanian devil): 100927283Help
Entry
100927283         CDS       T02286                                 

Gene name
PRKG2
Definition
protein kinase, cGMP-dependent, type II
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
cGMP-PKG signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term depression
Olfactory transduction
Salivary secretion
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    100927283 (PRKG2)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    100927283 (PRKG2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100927283 (PRKG2)
  Digestive system
   04970 Salivary secretion
    100927283 (PRKG2)
  Nervous system
   04730 Long-term depression
    100927283 (PRKG2)
  Sensory system
   04740 Olfactory transduction
    100927283 (PRKG2)
  Environmental adaptation
   04713 Circadian entrainment
    100927283 (PRKG2)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100927283 (PRKG2)
Protein kinases [BR:shr01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   100927283 (PRKG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 759 aa AA seqDB search
MGNGSVKPKQSKIPDGHAGKFSGTTDSLRSKVIELERELKKKDEELQQKEYHLRDLQEKL
SKQTIALAEITEELQNKCIQLNKLQDVVNIQGGNSLLFSPCKVSLQINRRSSGLVSLHSR
RGAKEGVSAEPTTKTFAEFSFEKARVRKDSSDKKLITDALNKNQFLKRLDPQQIKDMVEC
MYGRNYPQGSYIIKQGEPGNHIFVLAEGRVEVFQGNKLLSSIPMWTTFGELAILYNCTRT
ASVKAVSNVKTWALDREVFQNIMRRTAQARDEQYRQFLRSVCLLKNLPEDKLTKIIDCLE
VEYYDKGDYIIREGEEGSTFFILAKGMVKVTQSTEGNDKPQVIKTLQKGDYFGEKALISD
DVRSANIIAEENDVACLVIDRETFSQTVGTFEELQKYLEGYVANLNRDDEKRHAKRSMSG
WRQTKPLSLEMIQLKEKVAKFSSSSPFQNLEIVTTLGVGGFGRVELVKVKNENVAFAMKC
IRKKHIVDTKQQEHIYSEKKILEEMCSPFIVKFYRTFKDRKYVYMLLEACLGGELWSILR
DRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGS
GQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGMDQMMTYNLIL
KGIEKIDFPKKVTRRPEDLIRRLCRQNPTERLGNLKNGINDIKRHRWLNGFNWEGLKARS
LPSPLKRELNGPIDHSYFDNYPPEKGIPPDEMSGWDKDF
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatggctctgtgaaacccaaacagtccaagattccagatggccatgcggggaag
ttttccggcacaactgattcccttaggagcaaagtgatagaactggaaagggaactaaag
aagaaggatgaagagctgcagcagaaggaatatcatctgagagacctgcaagaaaagctc
tcaaagcagactattgctcttgctgagatcactgaagaactccaaaacaagtgcatccag
ctgaataagctacaagatgtggttaacattcagggaggaaactcacttctattttctcca
tgcaaagtgtctctgcagattaaccggaggagctctggcttggtctctctccacagcagg
agaggtgccaaggaaggggtatctgctgaaccaaccaccaagacctttgcagaattttca
tttgagaaagcaagagtcaggaaggactcaagtgacaagaagctcatcacagatgccctg
aataaaaatcagtttttgaagagattggatcctcagcagatcaaagatatggtggaatgt
atgtatggaagaaactatccacaaggcagttatattattaagcaaggagaacctggaaat
catatttttgtcttggcagagggaagagtagaggtattccaagggaacaagcttctatca
tcaatccctatgtggacaacatttggcgaactagccattttatacaactgcacaaggact
gcctcagtaaaagctgtctccaatgtgaagacgtgggcactagatagagaagtattccag
aatattatgagaagaacagcccaagctcgagatgaacagtatagacagttccttaggagt
gtgtgtttgttgaagaatttacctgaagataaactaaccaagatcattgactgcttagaa
gtggaatattatgacaaaggagattacatcatcagagagggggaggaaggaagcaccttt
ttcattttagccaaaggaatggtgaaagtcactcagagtactgaaggcaatgataaacct
caagttattaaaacactacaaaaaggtgattattttggagaaaaggctctcatcagtgat
gacgttagatcggctaacatcatcgcagaagaaaatgatgtggcatgcttggttattgat
cgagaaacattcagtcaaacagttgggacctttgaagaactccaaaagtaccttgaggga
tatgtggcaaatctgaatcgtgatgatgaaaaaagacatgccaagagatccatgtctggc
tggaggcagaccaaacctctgtctctagagatgattcagctaaaggagaaggtggccaaa
ttttcttcctcgtccccattccagaaccttgaaattgtcaccacactgggcgttggtggg
ttcggaagagttgaacttgttaaagtgaaaaatgaaaatgtggcatttgctatgaagtgt
ataaggaagaaacatattgttgatactaagcaacaggagcatatttattcagaaaagaaa
atcctggaagagatgtgttctccatttattgtaaaattttatcgtactttcaaggacaga
aagtatgtctatatgcttttggaggcctgtttaggtggggaactgtggagtattctaaga
gacaggggcagctttgatgaacccacttctaagttctgtgttgcctgtgtgacagaagca
tttgattatttgcatcgcctgggtattatctacagggatttaaagccagagaatttaatt
ctagatgctgagggataccttaaactggtggattttggatttgcaaagaagattggatct
ggacagaaaacgtggaccttctgcgggaccccggaatatgtggctcccgaagtcattctc
aacaaagggcacgacttcagtgtggatttttggtctttaggaatcctagtctatgaactg
ctgaccggcaaccctccattttctggcatggaccaaatgatgacttataatttgattctc
aagggaattgagaaaatagattttcccaagaaggtgacacgacgccctgaagatttgatt
cgccgactttgcaggcaaaatcctaccgaaagactgggaaacctgaagaatggaatcaat
gatatcaagaggcacaggtggctgaatggttttaactgggagggactgaaggcaagaagc
ttgccatcacctttaaaaagagagctcaatggacccatagatcacagctactttgacaac
tatccccctgagaagggtatacccccagacgaaatgtcaggttgggataaggacttctga

DBGET integrated database retrieval system