KEGG   Sarcophilus harrisii (Tasmanian devil): 100927341Help
Entry
100927341         CDS       T02286                                 

Gene name
PADI4
Definition
(RefSeq) protein-arginine deiminase type-4
  KO
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     100927341 (PADI4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 668 aa AA seqDB search
MALQSLVRLSLDQPTYAVCVMGTETVVDLQGCAPAECKFFEIDATPGVVFYINCRPTKKS
PSGTYKWPLESEVEMIVRMKAPSSHLNDQKIRISYIGSKSSSDKALLYLTGVKISLDVDT
CRKGKVKPTKGKIDKRNWTWGPSGQGAILLVNCDNDNPESSTVDAEQETVTNSKDLNDMS
LMILSTQAPKNFFNQHKLILHISKFEMDKVRVFQAEQKKMPSEYKMILGPKKPSHTLTVL
DSPQESIFYVEGLAFPDADFSGLISFTISLMDVSNLPSPEAPLFEDTVVFRVAPWIMTPN
TQAPQEVYVSKVYDNKNFVESVTALAKKAKCKLTICLEEENQDDRWMQDEMEIGYTQAPH
KLFPVVFDSPRNRGLKNFPIKRVLGPDFGYVTKIANKNLVGDLDSFGNLEVSPPVTVGEK
EYPLGRILIGNSSYPSDQSQEMLKVLQDFLFAQKVQAPVRLFSDWLHIGHVDEFLSFVPA
QDGKRFRLLLASPSACYKLFEEKQKEGHGDVKMFEGLWFPGIKNKTIKEILSDKTLQEHN
QYAKSCIDWNREVLKRELGLTEQDIVDIPQLFHLEWNSKNELKAKALFPDMVNMLVLGKH
LGIPKPFGPIINGQCCLEEKIRALLEPLGLECTFIDDFFQYHLKSGDVHCGTNVRRKPFP
FKWWKMMP
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggccctgcagagtctcgtcaggctgtcgctggaccaaccaacatatgctgtgtgcgtg
atgggcaccgagactgtggtggacctgcaaggatgtgccccagctgagtgcaagttcttt
gaaatcgatgcaacaccgggagtggttttttatatcaattgccgtcctaccaagaagtca
ccttcaggcacatacaaatggcccctggagtctgaggtggagatgatagtgagaatgaaa
gccccgagttcccatcttaatgatcaaaagatcaggatttcctatattggatccaaatca
agctccgacaaggccctgctctatctcactggtgtcaaaatctccctggatgttgacact
tgtcgaaaaggcaaagtaaaacctaccaaaggcaagattgacaagagaaattggacatgg
ggccccagtggacaaggtgctatcctgcttgtgaactgtgacaacgataatcctgaatct
tccacagtggatgctgagcaggagactgtgactaactccaaagacctgaatgacatgtcc
ctcatgattctgagcacacaagccccaaagaatttctttaaccaacataagctgattcta
catatttccaaatttgagatggacaaagtgagagtctttcaagctgaacagaagaaaatg
ccatccgaatacaagatgatactggggccaaagaagccatctcacaccctaacagtgctc
gatagcccccaagagagtatcttttatgtagaaggacttgccttccctgatgcggacttc
tcggggctcatttccttcaccatctctttgatggacgtttctaatctgccttcccccgag
gctccgcttttcgaggacaccgtggtgttccgtgtggccccctggatcatgacaccgaac
actcaggccccccaggaggtctatgtcagcaaggtttatgataacaagaactttgtggaa
tctgtgacagctctggccaagaaggccaaatgcaagttgaccatctgtcttgaagaagaa
aaccaggatgacagatggatgcaggatgaaatggagattggttacacccaggctcctcac
aaattatttcctgtggtctttgactcaccccgaaacagaggactgaaaaatttccctatc
aaaagagttctgggtccagattttggttatgtgacgaaaatagcaaataaaaatctggtt
ggtgacctggactcctttgggaacttggaagtcagcccacctgtgacagttggagaaaaa
gagtaccctctgggcaggatcctcattggcaacagcagctaccccagtgaccaaagccaa
gagatgctgaaggtgctccaggacttcctgtttgcccagaaggtccaggcaccagtcaga
cttttctctgattggttgcatattgggcacgtggatgagttcctcagctttgtcccagcc
caagatgggaagagattccggcttctcctggccagccccagtgcctgctacaagctattt
gaagagaaacagaaggaaggacatggagacgttaagatgtttgaaggactttggttccca
ggaataaaaaataagaccataaaagagattctgtcggacaaaaccttacaagagcacaat
caatacgccaagagctgcattgactggaaccgggaggtcctgaagcgggagctggggctg
accgagcaggacatcgtcgatattccccagctcttccatctcgagtggaattctaaaaat
gaactgaaagctaaggctttgttcccagatatggtgaacatgcttgtgctggggaagcac
ctagggatccccaagccctttgggcccatcatcaatggacaatgctgcctggaggaaaag
atccgagccctgctggagcctctgggcctggagtgcactttcattgatgactttttccag
tatcacctcaaatcaggagacgtgcactgtggaaccaacgtccgcaggaagcccttcccc
tttaagtggtggaagatgatgccctga

DBGET integrated database retrieval system