KEGG   Sarcophilus harrisii (Tasmanian devil): 100927343Help
Entry
100927343         CDS       T02286                                 

Gene name
USP24
Definition
ubiquitin specific peptidase 24
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100927343 (USP24)
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100927343 (USP24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 2763 aa AA seqDB search
MPRIAADPRGPAFARPEAPPPSESREKRSAAAPASPPPPLPGSGAFRERRRAEGGASSGR
DRGLWSGRPGGERRGGAPGAAEGTGLGLVKDSGHLRSGGGAARGLSPGPRPPGTLRREGP
RRVGSGCGVWVVKVCGMNLEKRWRRPARRREQKPLACAWSLFPSDGGSRGLALSCRGGQP
GRDRGGNRKTFSAPFLSAMLVTLGRTPKLLDRTAPLRVPLGAAQLGAARPTDRAWRPVGS
QRAALQASVSVRKNDENGNCSGDNIEFPTTNLYELESRVLTDHWSIPYKREESLGKCLIA
SARLARLGLSESDENCKRFVDRCMPEAFKKLLTSSAVHKWGTEIHEGIYNMLMLLVDLAA
ERVKQDPIPIGLLGVLTMAFNPDNEYHFKNRMKVSQRNWAEIFGEGNMFAISPVSAFQKE
PHGWLVDLVNRFGELGGFAAIQSKLHSEDVELGAVSALVQPLGVCAEYLNSSVVQPMLDP
VIHKMIKYVQSVEEKDLKDKRLVSIPELLSAIKLLCMRFQPDLVMVVDDLRLDILLRMLK
SPHFSAKMNSLKEVTKLIEDSTLSKSVKNAIDTDRLLDWLVENSVLSIALEGNIDQAQYC
DRIKGIIELLGSKLSLDELTKIWRIQAGQSSTVIENIHTIIAAAAVKFSSDQLNHLFVLI
QKSWETENDRVRQKLLSLIGRIGREARFETTSGKVLEVLWDLAHLPTLPSSLIQQALEEH
LTILSDAYAVKEAIKRSYIIKCIEDIKRPGEWSGLEKNKKDGFKSSQHNNPQFVWVVPAL
RQLHEITRSFIKQTYQKQDKSIIQDLKKNFEIVKLVTGSLIACHRLAASVSAPGGLTGST
LVDGRYTYREYLEAHLKFLAFFLQEATLYLGWNRAKEIWECLVTGQDVCELDREMCFEWF
TKGQHDLESDVQQQLFKEKILKLESYEITMNGFALFKTFFENVNLCDHRLKRQGAQLYVE
KLELVGMDFIWKIAMESPDEEIANEAIQLIINYSYINLNPRLKKDSVSLHRKFIADCYAR
LEAASSALGGPTLTHAVTRATKMLTATAMPTVATSVQSPYRSTKLVIIERLLLLAERYVI
TIEDLYSVPRTILPHGASFHGHILTLSVTCESTKDTFTVEAHSNETIGSVRWKIAKQLNS
PVDNIQIFANDSLLTVNKDQKLLHQLGFSEEQALTVKTSGSGTPSGGSADSSTSSSSSGG
VFSSSYVMEQEKSLPGVVMALVCNVFDMLYQLANLEEPRITLRVRKLLLLIPTDPAIQEA
LDQLDSLGRKKTLLSETSSQSSKSPSLSSKQQHQPSASSILESLFRSFAPGMSTFRVLYN
LEVLSSKLMPTADDEMARNCAKSFCENFLRAGGLSLVVNVMQRDSIPSEVDYETRQGVYS
ICLQLARFLLVGQTMPTFLDEDLTKDGIEALASRPFRNISRQSSRQMSLCGTPEKASYRQ
LSVSDRSSIRVEEIIPAARVAIQTMDVNDFTSTVACFMRLSWAAAAGRLDLVGSSQPIKE
SNTLFPIGIRNRLSSSGSNCSSGSEGEPVALHAGICVRQQSVSTKDALIAGEALSLLVTC
LQLRSQQLASFYNLPCVADFIIDILLGSPSAEIRHVACDQLYTLSQTDTSAHPEVQKPNQ
FLLGVILTAQLPLWSPTSIMRGVNQRLLSQCMEYFDLRCQLLDDLTTSEMDQLKISPAAM
LEDEITWLDNFEPNRTAECETSEADNILLAGHLRLIKTLLSLCGAEKEMLGSSLIKPLLD
DFLFRASRIILNSHSPVGSAAISQQDFHPKCSTVNSRLAAYEVLVMLADSSPSNLQIITK
ELLSMHHQPDPALTKEFDYLPPVDSRSLSGFVGLKNGGATCYMNAVFQQLYMQPGLPESL
LSVDDDMDNPDDSVFYQVQSLFGHLMESKLQYYVPENFWKIFKMWNKELYVREQQDAYEF
FTSLIDQMDEYLKKIGRDQIFKNTFQGIYSDQKICKDCPHRYEREEAFMALNLGVTSCQS
LEISLDQFVRGEVLEGSNAYYCEKCKEKRTTVKRTCIKSLPSVLVIHLMRFGFDWESGRS
IKYDEQIRFPWMLNMEPYTVSGMARQDSSCDVGENGRHVDQGSGGSPRKKVAPTENYELV
GVIVHSGQAHAGHYYSFIKDRRGCGKGKWYKFNDTVVEEFDLNDETLEYECFGGEYRPKV
YDQSNPYPDVRRRYWNAYMLFYQRVSDQNSPVLPKKSRVSVVRQEAEDLSLSAPSSPEIS
PQSSPRPHRPNNDRLSILTKLVRKGEKKGLFVEKMPVRIYQMVRDENLKFMKNRDVYSSD
YFSFVLSLASLNATKLKHPYYPCMAKVSLQLAIQFLFQTYLRTKKKLRVDTEEWVATIEA
LLSKSFDACQWLVEYFVGSEGRELVKIFLLECSVREVRVAVATILEKTLDSALFYQDKLK
SLHQLLEVLLALLDKDVPENCKNCAQYFFLFNTFVQKQGIRASDLLLRHSALRHMINFLL
GPNRQSNQIRRWSSAQAREFGFLHNTVALLVLHSDVSSQRNVAPGIYKQRPPMSIVSSGP
LLALHEEVESLLFLSEGKPYLLEVIFALRELTGSLLALMEMVVYCCFCNEHFSFTMLHFI
KSQLETAPPHELKNTFQLLHEILVIEDPLQVERVKFAFETENGLVALMHHSNHVDSSRCY
QCVKFLVTLAQKCPAAKEYFKENSHHWSWAVQWLQKKMSEHYWVPQSNISNETSTGKTFQ
RTISAQDTLAYATALLNEKDQSGSSNGSESSPANENGERHLQQGSESPMMIGESRSDLDD
VDP
NT seq 8292 nt NT seq  +upstreamnt  +downstreamnt
atgccgagaatcgcagccgacccgcgaggccccgccttcgcccgcccggaggccccgcct
ccttccgagtcgcgtgagaagcgctctgcggcggctcccgcgtctcctcccccgcccctc
cccggaagcggcgccttccgggagcggcgcagggcggaggggggcgcgagctccgggcgt
gatcgaggactctggtccgggagacccggaggggagcggaggggaggggcgcctggggcc
gccgaggggacaggcctggggctggtcaaggactctggtcacctccggagtgggggaggg
gcagcgagggggctgagtcctggcccccggcccccgggcaccctcaggagggagggtcca
agacgggtgggctcgggatgcggagtttgggtggtcaaggtttgtggcatgaacctagag
aaaagatggaggcggccggcccgccggcgggagcaaaaacccctggcctgtgcttggtca
cttttcccgagtgatggagggagcaggggcctggctctgtcctgcagagggggtcagcct
ggccgtgatcgcggcgggaatcggaagacctttagtgccccctttctttctgctatgttg
gtgaccttgggcaggacacccaaacttctggaccggactgctcctctccgggttcccctg
ggcgcagcccagctcggggctgccaggccaacagatcgggcctggaggcccgttgggtct
cagagggccgctttgcaggccagcgtcagtgtcagaaagaatgatgaaaatggcaactgt
tctggggacaatattgaatttcctacaaccaacttatatgaactggaaagccgcgttttg
actgatcattggtccataccttacaaacgggaagaatcattgggaaaatgcctgatagct
tctgcccgccttgcaaggctgggtctttctgaatctgatgaaaattgtaaaagatttgtg
gatcggtgtatgccggaagcatttaaaaagttattgacctccagcgccgttcacaagtgg
ggcacggaaatccacgagggaatctacaacatgctgatgttgttggtcgatctagctgca
gagcgagtcaagcaagaccccatccccatcggtctcctgggagtgctcacaatggctttt
aatcccgataatgaataccattttaaaaaccggatgaaagtatctcaaagaaattgggct
gagatttttggagaaggaaatatgtttgccatctctcctgtatctgctttccagaaggaa
cctcatggatggcttgtggatttggttaataggtttggtgaattaggtggatttgcagca
attcaatctaaacttcattcagaagatgtagaacttggggctgtctctgcgctagtccag
ccactgggggtttgtgcggaatacctcaactcctcagttgtgcagccaatgcttgatccg
gtcattcacaaaatgattaaatacgtgcagagtgtggaagagaaggatctgaaggacaag
aggctggtgagcatccctgagctcctgtcggctattaaactgctctgtatgcgcttccaa
cctgacttggtgatggtggtggatgacctgcggctggacatcctgctccgcatgctgaag
tcgccccatttcagtgccaaaatgaattccctcaaagaggtaaccaaactaatagaagac
agcactttatccaaatctgtgaagaatgcaatagatacagaccgattattagattggcta
gttgagaactctgttctgtcaatcgcattggaaggtaatattgatcaagcacaatattgt
gatcgcataaaaggaattattgaactactgggcagtaaattatctttagatgagctcaca
aaaatttggagaatacaggcaggacagtcatccactgtcattgagaacatccacactatt
attgctgcagccgctgtgaagttcagctcagatcagctgaatcatctctttgtcctcatc
cagaagagctgggagacagaaaacgaccgagtcagacagaagttgttgagcctgattggg
cgcattggccgtgaagctcgcttcgagaccacctctggaaaggtccttgaagtcctctgg
gatttggcccatctgcccaccttgcccagcagcctcattcagcaagctttggaggagcac
ttgaccatccttagcgacgcctatgcggtgaaggaagctatcaagagaagctacatcatt
aagtgcattgaagacattaaacggcctggagagtggtcaggtttggaaaaaaacaagaag
gatggattcaagtcatcccagcataacaacccccagtttgtttgggtggtccccgcttta
cggcagctccacgagatcacccgatcatttataaaacaaacctatcaaaagcaagacaag
agcatcattcaggacttgaaaaaaaattttgaaatagtcaaactggtaacgggaagtttg
atagcatgtcaccgacttgcagcatctgtatcagcacctgggggcttaactggttcaaca
ctggtggatggccgatacacttatcgggagtatttagaggcgcacttaaaatttctggca
tttttcttgcaagaagccactctgtatctgggttggaatcgagctaaggaaatctgggaa
tgtcttgtgacgggacaagatgtttgtgaattggatagagagatgtgttttgagtggttt
acaaaaggacagcatgatcttgaaagtgacgttcagcagcagctcttcaaggagaaaatt
ctcaaactggaatcgtatgaaattactatgaatggttttgccctatttaagaccttcttt
gaaaatgtgaatctctgtgatcatcgattaaagcgacagggtgctcagctgtacgtagag
aagttggaattggttgggatggattttatttggaaaattgcgatggagtcacctgatgaa
gaaatagctaatgaggccattcagctgatcataaactacagttatattaacttaaatcca
agattgaagaaggattccgtgtctctgcacaggaagttcatcgctgattgctatgcccgc
ctagaagcagccagctcggcacttggcggcccaaccctgactcatgctgtgaccagagca
accaaaatgctcacagcgaccgccatgcccaccgtggcgacatctgtacagtctccatac
aggtctactaagctagtcatcattgagaggctactcctgctggccgagcgctacgtaatc
accattgaggacctttattctgttcctcgcactattctacctcatggcgcttcattccat
ggacatattttgactctcagtgtgacgtgcgaatctaccaaagataccttcactgtagag
gctcatagtaacgaaaccatagggagcgtcaggtggaagatagcaaagcagttgaattcc
cccgtggataacatacagatatttgcaaatgatagtctgctcacagtgaacaaggatcag
aagctgctccatcagctgggcttttccgaggagcaggccctcacagtcaagacgtctggt
agtggcaccccttcggggggctctgcagactcctccaccagctccagcagcagcggcggc
gtcttcagctcctcttatgtcatggaacaggagaagtccctcccaggtgttgtcatggca
cttgtatgcaacgtatttgacatgctttaccagctcgccaacctggaggagcccaggata
acactacgagtgcgaaagctgctattgttgatacctactgacccagctattcaggaagcc
cttgatcagctcgactctttaggacgaaagaaaacactgctgtctgaaacaagttctcag
tcttcaaaatctccgtccttgtcttcaaagcaacagcatcagcccagtgccagctccatt
ttggaaagtctttttcgatcttttgcccccggaatgtcaactttcagagtactgtacaac
ctagaggtcctgagctccaaactcatgccaacagctgatgatgaaatggccaggaactgt
gcaaaatccttctgcgagaacttcctcagggcaggcggcttgagcttggtggtcaatgtc
atgcagagagactctataccttcggaagtggactatgaaacaaggcagggagtttattcc
atctgtctgcagcttgcaagattcttacttgtcgggcagaccatgcccacgttcttggat
gaagatctcaccaaagatggcattgaggcgctcgcttcccgtcccttccgcaacataagc
cgtcagtccagccggcagatgtccctgtgcgggactccagagaaggcctcctacagacag
ctctcggtctctgacaggtcctccatccgggtggaggaaatcatccctgctgccagagtc
gccatacaaacaatggatgtaaatgatttcacttctactgtggcttgtttcatgaggctg
tcctgggcagcggctgcaggacgtcttgaccttgttgggagcagccagccgataaaagaa
agcaacactttgtttcctattgggattcgaaacagactcagcagctcaggaagcaactgc
agctctgggagcgaaggcgagccggtcgccctgcacgcggggatctgcgtgcggcagcag
tccgtgtccaccaaagatgcgctcatcgccggcgaggccctctcgctgctggtcacctgc
cttcagctccgcagtcagcagctggcgtccttctataacttgccgtgtgtggccgatttc
atcattgacattctgctcggatctccgagtgccgagatccgtcatgtggcctgtgaccag
ctgtatactctcagccagacggacacgtctgctcacccagaagtgcagaagccaaatcag
tttctcctcggggtcattcttactgctcagctgccgctctggtctcccacgagtatcatg
agaggcgtcaaccagaggctcttgtcccagtgcatggaatactttgatctgaggtgtcag
ttacttgacgacctgacaacttcagaaatggatcagctaaagatcagtccggctgccatg
ctagaggatgaaattacttggctagataattttgagcctaatcgtacagctgaatgtgaa
accagtgaagcagacaacattctgttagctggacatttaagactcatcaagaccctcctt
tcactctgtggagcagagaaagaaatgcttgggtcgtcacttatcaaaccattgttggat
gacttccttttccgggcttccaggattattttaaacagtcattctccagttggcagtgct
gccatcagtcaacaggattttcatccaaaatgtagtactgtgaacagtcggttggcagcc
tatgaagttctggtgatgttggctgatagctcaccctccaatcttcaaattattacaaaa
gagctgctttctatgcaccatcaacctgatcctgctctcaccaaggaatttgattatctt
cccccagtggacagccgctccctctcaggattcgtggggctcaagaatgggggtgccacc
tgctacatgaatgcagttttccagcagctctatatgcagcccggcctccctgagtcttta
ctttccgttgatgacgatatggacaatccagatgatagcgtgttctatcaagtccagtcc
ctctttgggcatttgatggaaagcaagctgcaatactatgtgcctgagaatttttggaag
attttcaagatgtggaacaaagagctttatgttcgagagcaacaagatgcgtatgaattc
tttactagcctcatcgatcagatggatgaatacctcaagaaaattggtcgagatcagata
tttaagaatactttccagggaatctactctgatcagaagatatgtaaggactgtcctcac
aggtatgagcgagaagaagctttcatggcgctcaatctcggtgttacttcttgtcagagt
ctggagatttctttggaccagtttgttagaggtgaagttctagaggggagtaatgcctat
tactgtgaaaagtgtaaagaaaagagaacgacagtgaaaaggacatgcattaagtctttg
cccagcgtcttagtgattcacctgatgagatttggatttgattgggagagtggacgctct
attaaatatgatgaacaaataaggttcccctggatgttaaacatggagccttacacggtt
tcaggaatggctcgccaggactcatcttgtgatgttggtgaaaatggtcggcatgtggac
cagggctctggaggatccccacggaagaaagtggcccccactgaaaactacgagctcgtc
ggtgtgattgtgcacagcggccaggcccatgcaggccactattattcctttatcaaggac
cggaggggatgtggaaaaggaaaatggtataagtttaatgacactgtggtggaagagttt
gatttaaatgatgaaaccttggagtatgaatgttttggtggcgagtacaggccaaaagtc
tacgatcagtcaaatccataccctgatgtacgccggcgatactggaatgcttatatgctc
ttctaccagagggtgtctgaccagaactccccggtgctgccaaagaaaagccgagtcagc
gtggtgcgccaggaggccgaagacctctccctatcagctccgtcttcaccagagatttca
ccacagtcatctcctcggccccacagacctaacaatgaccgtctctctattttaaccaag
ctggttagaaaaggggagaaaaaaggactctttgtggaaaaaatgcctgtgaggatatac
cagatggtgagagacgagaacttgaagttcatgaagaatagagatgtctatagtagtgac
tatttcagttttgtcctgtctttagcctcactaaatgctactaaattaaaacacccctac
tatccttgcatggcaaaggtgagcttacagttagcaatccagtttctcttccaaacctat
ttacggacaaagaaaaaactcagggttgacacagaagaatgggtggccacgattgaagcc
ttgctctccaaaagttttgatgcttgtcagtggcttgttgaatatttcgttggttctgaa
ggtcgagagttggtaaagatcttcctcctggagtgcagcgtgagagaagtgcgagtggct
gttgccacaattctggagaagacgctcgacagtgccttgttctaccaggacaagctcaaa
agtcttcaccagttgttggaagtgctgcttgccctgttggataaagatgtcccagagaac
tgtaaaaactgtgctcagtactttttcctgttcaacacctttgtacagaagcaaggaata
agggctagcgatcttcttttgagacattctgctctacgtcacatgatcaactttctcctg
ggacccaatcggcaaagcaatcagattcgccgatggagctcggcccaggcccgggagttt
ggcttcctccacaacacggtggcgctgctggttttacactcagatgtctcgtcacagagg
aacgtcgcccctggcatctataaacagcggcctcccatgagcatcgtgtcttctggccca
cttctggccctccatgaggaagtggagtccttgctcttcctgtctgaagggaagccatac
ttgcttgaggtcatctttgccttgcgggagctgaccggttcacttctggctctcatggag
atggtggtctactgctgtttctgcaacgagcacttctccttcaccatgttgcatttcatc
aagagccaactagagaccgctcctccccacgaattaaaaaacacattccagctgctccac
gagatcctggtcattgaggaccctcttcaagtagaacgggtcaagtttgctttcgagaca
gaaaatggattagtagccttgatgcaccacagcaatcacgtggatagcagtcgctgctat
cagtgtgtcaagttcctcgtgaccctggcacaaaagtgtcctgctgctaaagaatacttc
aaggagaattcccaccattggagctgggcggtgcagtggctacagaagaagatgtctgaa
cattattgggtcccacaaagtaatatatctaacgaaacgtcaactggaaaaacctttcaa
cgcacgatttccgctcaggacaccttggcgtacgccacggccctgctgaacgagaaggat
cagtccgggagcagcaacgggtccgagagcagccctgccaacgagaacggggagagacac
ctgcagcagggctccgagtctcccatgatgattggcgagtcaagaagtgacctggatgat
gtggacccttag

DBGET integrated database retrieval system