KEGG   Sarcophilus harrisii (Tasmanian devil): 100927376Help
Entry
100927376         CDS       T02286                                 

Gene name
CAPN1
Definition
(RefSeq) calpain 1
  KO
K01367  
calpain-1 [EC:3.4.22.52]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100927376 (CAPN1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100927376 (CAPN1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100927376 (CAPN1)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     100927376 (CAPN1)
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C2: calpain family
   100927376 (CAPN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 741 aa AA seqDB search
MTLGRRPSQPLPSSKVEETEAQSYKTMTEEVIVPVYCTGVSAQVQKQRAKDLGLGLHENS
IKYLGQDYEKLRSQCLQSGVLFEDDTFPASAHSLGFKDLGPKSSKTYGIKWKRPTELLPN
PRFIVDGATRTDICQGALGDCWLLAAIASITLNDTILHRVVPHGQSFQEGYAGIFHFQLW
QFGEWIDVVVDDLLPTKDGKLLFVHSAQGNEFWSALLEKAYAKVNGSYEALAGGSTSEGF
EDFTGGVTEWFDLKKPPSDLYYIILKALERGSMLGCSIDITSAFDMEAVTFKKLVKGHAY
SVTGAQQVTHRGRSVNLIRMRNPWGEVEWTGPWSDNSSEWSQVAPSDRQQLQVKMEDGEF
WMSFSDFLREFTRLEICNLTPDTLKSQKFRKWNTTLYDGTWRRGSTAGGCRNYPATFWVN
PQFKIKLEEVDDPSENFCGRDDGCSFLLALMQKNRRRERRFGRDMETIGFAIYEVPDHLV
GQPSVHLKRDFFLSHSSLARSEQFVNLREVSSRICLPPGEYIVVPSTFEPNKEGDFVLRF
FSEKKAGTEELDDKIEADLPDEKVLSEEEIDSTFKDLFKQLAGEDEEISVKELQTILNKI
ISKHKDLRTDGFSKESCRSMVNLMDRDGNGKLGLVEFNILWNRIKNYLSIFRKYDLDKSG
SMSSYEMRMALEAAGYKLNKKLHGLIITRYSEADLNLNFDSFVCCLVRLETMFRFFQALD
TDKDGIVNFDLFRWLQLTMFA
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgactctgggaaggcgtccatctcaaccccttccctcctctaaggtggaagaaacggag
gcccaatcctacaagacaatgacagaagaggtcatcgtccctgtgtactgcacgggggtg
tctgcccaagtgcaaaaacagagagcaaaggacctaggactgggcctccatgaaaactcc
atcaagtacctgggccaggattacgagaagctacggtcccagtgcctgcagtctggggtc
ctttttgaggatgatactttccccgctagtgcccattccctgggcttcaaggacctggga
cccaaatcctccaaaacctatggcattaaatggaaaaggcccacggaacttttaccaaac
cctcggtttattgtggatggggccacccgaacagacatttgtcagggagctctgggggac
tgctggctcctggcagccatcgcctccatcaccctgaacgacaccatcctgcaccgggtg
gtgcctcatgggcagagttttcaggaaggctatgctggcatctttcacttccagttgtgg
cagtttggggagtggatcgatgtggttgtggacgacctgctgccaaccaaggatggaaag
ctgctctttgtgcactcggcccaaggcaatgagttctggagtgccctgcttgagaaagcc
tacgccaaggtgaatggtagctatgaagcccttgctgggggtagcacctcagagggattt
gaagactttaccggaggtgttacagaatggtttgacctcaagaaaccacctagtgatctc
tactacatcattctgaaggccctggaacgggggtccatgctgggctgttccatcgatatc
accagcgcctttgacatggaagccgtcaccttcaagaaactggtgaagggccacgcctac
tcggtgaccggagcccagcaggtgacccatcggggccgctcggtgaacctaattcgaatg
cggaacccgtggggtgaggtggagtggacggggccttggagtgacaattcctctgagtgg
agccaggtggccccctctgataggcaacagctccaggtcaagatggaggatggggagttc
tggatgtccttcagtgactttcttcgggagttcacccgcctggagatctgcaacctgacc
ccagacaccctcaagtcccaaaagttccgcaaatggaacacaaccctgtatgatggcacc
tggagacgtggaagcacagcgggtggctgcagaaactacccagccaccttctgggtgaac
ccccagtttaaaatcaagctggaggaggtggatgatccctccgaaaatttctgtggtcga
gatgacggctgcagcttcctgctggcgctcatgcagaagaaccggcgccgagagcggcgc
tttggccgggacatggagaccattggctttgcgatctatgaagtccctgatcacttggtg
ggccagccttctgtgcacctgaagcgggacttcttcctgtcgcactcgtccctggcccgc
tcggagcagttcgtcaacctgcgggaggtcagctcgcgcatctgcctgcctcccggggag
tacatcgtggtgccctccacctttgagccaaacaaggagggggactttgtgctgcgcttc
ttctctgagaagaaggccgggacggaggagctggatgacaagattgaagctgacctgccc
gatgagaaagtgctttccgaagaagagatcgatagcaccttcaaggatctttttaagcag
ttggctggggaggacgaggagatcagcgtcaaggaactgcagaccatcctgaacaaaatc
atcagcaaacacaaagatctccggaccgatggcttcagtaaggagtcgtgccgaagtatg
gtgaatctcatggatcgggacggcaatgggaaactggggctggtggagtttaacatcctc
tggaaccgaatcaaaaattacctgagcatctttcgaaagtatgacctagacaagtcgggc
agcatgagttcctacgagatgcggatggctcttgaggcagcagggtacaagttgaataag
aagctgcatggactaatcataactcgctactcagaggctgacctgaacttgaactttgac
agctttgtgtgctgtctcgtgcggctggagaccatgttccgatttttccaggccctggac
acagacaaagatggaattgtgaattttgacttatttaggtggttacagttgaccatgttt
gcgtga

DBGET integrated database retrieval system