KEGG   Sarcophilus harrisii (Tasmanian devil): 100927475Help
Entry
100927475         CDS       T02286                                 

Definition
cocaine esterase-like
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Drug metabolism - other enzymes
Class
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:shr00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 551 aa AA seqDB search
MWTTSVLPKVLTLGVLGLLIQASGYNADDLIRTTESGQIQGSKISIKGIDKDVNIFLGIP
FAKPPVGALRFSPPQPPDSWSNVRDATSHPPICLQDVSILEKASRTAKINIPTTANSEDC
LYLNIYVPDHAEKGNRLPVMVWIHGGGLVIGSASMYDGSILSASQNVIVVTIQYRLNILG
FFSTGDEYAPGNWGYLDQVAALKWVQKNIAHFGGDPNCVTIFGESAGGTSVSSHVLSPMS
KGLFHRAIMQSGVAILPGLISSSSEMVANVIANLSACERYSSASMVQCLRRKSEEEILAI
GKHFNIIPGVVDGQFFPQHPEELLAAGKFHQVPSIIGINNHEYGWVIPAIMSVPGFKENM
DKESILSSLQSPLWNIPLELGHLMIEEYIKNTEDPGEHRAQFQEMLGDLTFVIPGLKVAK
YQHSPSSPVYFYEFQHRSSIFKGVRPDYVKADHGDELQFVFGTPFLGETTEEEKLLSHRI
MSYWANFAYHGDPNGADLLHWPVYDQKEEYLQLNLQLSVGKSLKADKLEFWTKTVPQKMK
ELQFEKARVEL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgtggacgacttctgtgttgcccaaggtcttgactttgggggtcctgggcctcctgatt
caagcctcagggtataatgctgatgacctcatcaggactactgaatctggacagatccaa
ggaagtaagatcagtatcaaaggcattgacaaagatgtcaatattttcctaggaatccct
tttgccaaaccccctgtgggggccctgaggttttctcctccacaaccaccagattcttgg
agcaatgtgagagatgcaacttctcatccacctatatgtttgcaggatgtcagtatccta
gaaaaagcttccagaactgcgaaaataaacatccctactactgccaattctgaagactgt
ttgtacctcaacatctatgttcctgaccacgcagagaaggggaacagattgccagtgatg
gtgtggatccatggtggtggtctcgttattggctctgcttccatgtatgatggttcgata
ttgtctgcttcccagaatgtaatagtggtgaccattcagtatagactgaacatccttgga
ttcttcagcactggggatgagtatgcacctggcaactggggctacctggatcaggtggct
gccctgaagtgggtccagaagaacattgctcactttggaggagatcctaactgtgtgacc
atttttggcgaatctgctggaggaactagcgtttcttcacatgttctgtctcccatgtcc
aaagggttgttccacagggccatcatgcagagtggtgtggccatcctcccaggcttgatt
tcttccagctcagaaatggttgcaaatgtcattgccaatctgtctgcttgtgagagatac
agttctgcctccatggttcagtgccttaggagaaaatctgaagaggagatcctggccatt
ggcaagcatttcaacataatccctggtgtagttgatggacaattcttcccccaacatcct
gaagagttgctggctgcaggaaagttccaccaggtcccctccatcattggcatcaacaac
catgaatatggctgggtcattcctgctataatgagtgttcctggatttaaggaaaatatg
gataaagaaagtatcctatcatcattgcaaagtccattgtggaatattcctcttgaactt
gggcatctgatgattgaagagtatataaaaaatactgaggaccctggagaacatcgagct
caatttcaggaaatgttaggagatttgacctttgttatccctggcctcaaagttgccaag
tatcaacatagtcccagctctccagtctacttctatgaatttcagcaccgatccagcata
tttaagggtgtcaggccggattatgtgaaagcggaccatggtgatgagctgcagtttgtc
tttggaactccttttctaggtgagacaacagaagaagaaaaactcctgagccacaggata
atgagctactgggcaaattttgcctatcatggggacccaaatggtgcagaccttttgcac
tggccagtctatgaccagaaggaagagtatctgcagctgaatttgcagctgtctgtggga
aagagcctgaaggcagataaattggagttctggactaagactgtacctcagaagatgaag
gaattgcagttcgaaaaagctcgggtggagttgtga

DBGET integrated database retrieval system