KEGG   Sarcophilus harrisii (Tasmanian devil): 100927549Help
Entry
100927549         CDS       T02286                                 

Gene name
POMT2
Definition
(RefSeq) protein O-mannosyl-transferase 2 isoform X1
  KO
K00728  dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00514  Other types of O-glycan biosynthesis
shr00515  Mannose type O-glycan biosynthesis
shr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosyntheis
    100927549 (POMT2)
   00514 Other types of O-glycan biosynthesis
    100927549 (POMT2)
Enzymes [BR:shr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     100927549 (POMT2)
Glycosyltransferases [BR:shr01003]
 O-Glycan biosynthesis
  O-linked Man type
   100927549 (POMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMT MIR
Motif
Other DBs
NCBI-GeneID: 100927549
NCBI-ProteinID: XP_023357672
Ensembl: ENSSHAG00000007082
Position
1
AA seq 557 aa AA seqDB search
MSPAAVGVGPAESGLRLRRGRGRMKAAGTAVSGPELAAGDGGLCPKLTPQSKPKIPEQVM
GWLLLAAVTTLAFATRFHRLHEPAHVCWDETHFGKMGSYYINRTFFFDIHPPLGKMLIGL
AGYLSGYDGTFPFQKPGDKYKHHNYIGMRGLCAFLGSWLIPFAYLTVLELSKSRPAALLT
AALFTFDTGCLTLSQYILLDPILMFFIMAAMLSMVKYNSCADRPFSVSWWFWLSLTGISL
AGALGVKFVGLFIVLHVGLNTVSDLWQLLGDLNLTMVTLGKHLAARILCLIVFPLILYTA
IFAVHFLVLNKSGPGDGFFSSAFQSRLLGNNLHNASIPEHLAYGSVITVKNLRMASGYLH
SHCHLYPEGVGARQQQVTAYQHKDYNNLWIVKKHDVNTDPLDPSFPVEFVKHGDIIRLEH
KETSRNLHSHQHEAPMTRKHYQVTGYGVNGTGDSNDFWRIEVMNRKSENRIKVLRSQIRL
IHLATGCVLGSSGKTLPKWGWEQLEVTCTPYLKETPNSVWNVEDHINPKLPNINLDVLKP
SFMEILLESHMVMIRVR
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgagtccggcggcggtgggagtaggcccggctgagtccgggcttcgcctccgtcggggc
cgcggcaggatgaaggctgccgggactgcagtgtcaggaccggagcttgccgccggggat
ggcggcctatgccctaagctgactccacaatcgaaaccaaagatccccgagcaggtcatg
gggtggctcctgttggccgcggtcaccacactggccttcgccactcgcttccaccggttg
cacgagccggcgcacgtctgttgggatgaaactcattttggaaaaatgggaagttactat
ataaatcgtacctttttctttgatattcacccacctctgggaaagatgctcataggactt
gctggttacctgagtggttatgatggcacctttcctttccagaagcctggggacaaatac
aaacatcataattatattgggatgagagggttgtgtgctttcctgggctcctggttgatt
ccttttgcctacctcactgtgctagagctatctaagtcccggccagcagccttgctaact
gctgctttgtttacctttgataccggctgccttactttgtcacagtacatacttctggat
cccatcctcatgttctttatcatggctgcaatgctgagcatggttaagtataactcctgt
gcagataggcccttctctgtctcttggtggttctggctcagtttgacaggaatcagtctt
gctggtgctttaggggtcaaatttgttggcctctttattgtcctccatgtaggattgaat
acagtttcagacctttggcagctgctgggagaccttaatcttacaatggtaacactggga
aaacatttggcagctcggatcttgtgcctcattgtgtttcctcttattctctatactgcc
atatttgcagttcacttcctggtattgaataaaagtggccctggtgatggcttttttagt
tctgccttccagtctcggctgttagggaacaaccttcacaatgcttccattccagaacac
ctggcatatggatctgtgattacggtgaagaatctccgaatggccagtggatatctccat
tcacattgtcacctttatccagaaggagttggtgcacgtcagcagcaggtaactgcctat
cagcacaaggattataacaatttgtggattgtgaagaaacatgatgtcaacacagatcct
ctggatccctctttcccagtggagtttgtgaaacatggagatatcattcggctggaacat
aaagagacttctcgaaacctacatagtcatcagcatgaggccccaatgacccggaagcat
tatcaggtcactggctatggtgtaaatgggacaggcgattcaaatgatttctggaggatt
gaggtgatgaataggaaatctgagaatcggatcaaggttctgaggagtcaaattcgactc
attcatctggccacgggctgtgtcctgggttcctcaggaaagacactacccaaatggggc
tgggaacagctggaagtgacctgcactccatacttgaaggagacccctaattctgtctgg
aatgtggaagaccatatcaatcccaaattgccaaacatcaacttggatgtcctgaaaccc
agttttatggagatcctactggaatcccacatggttatgatccgggtaaggtga

DBGET integrated database retrieval system