KEGG   Sarcophilus harrisii (Tasmanian devil): 100927958Help
Entry
100927958         CDS       T02286                                 

Definition
ubl carboxyl-terminal hydrolase 18-like
Orthology
K11846  
ubiquitin carboxyl-terminal hydrolase 18/41 [EC:3.1.2.15]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100927958
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100927958
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 314 aa AA seqDB search
MKRKTVQLRYLCSAGDSHKGPVGLYNIGQTCCLNSLLQVFMMNQNFAKILKSITMPRGLE
ERKRSVPYQLLLLLEKMQDSRLKAVWPMELVFCLQNYNLPLFVQHDAAQLFLTLWNLIQN
QITDPELSERLKTLYTITMRESLNCLDCGVKNQRDSYTLILSLSLFDTDSQPLKTLEDSI
HCFFQPTKLSGKNKCFCENCGKMTCWEQTQKITHLPPTLTFHLRRFSSTNFSETQKVIHP
LSFPKNLIFSPEQDWWDSEEQKYELFAVVAHMGTANYGHYCAYICNSADGRWFCFNDSSV
CWGRNSLSSGLHEG
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaaaaacagtgcagttgagatatctttgcagtgctggagacagccataaaggt
cctgttggtttgtacaacattggacagacttgttgcctcaactctttgctccaggtgttc
atgatgaaccagaattttgccaaaatcttgaagagtatcaccatgcctaggggattggag
gaacgaaagagaagtgtcccttaccaactgcttctgctcttggagaagatgcaagacagc
cggttgaaagcagtatggcccatggagctggtattctgcctgcaaaactataatcttcca
ttgttcgttcagcacgatgctgcccaactcttcttgaccctttggaatttgattcagaac
caaattacagacccagagttgtcagagaggctgaagactttgtacacgatcacaatgcgg
gagtccttgaattgtttagactgtggtgtgaagaatcaaagggatagctacacattgatc
ctttcgctctctctttttgatactgactcacaacctctgaaaaccctggaggattccata
cattgttttttccagcccacgaagttgtcaggcaaaaacaaatgtttctgtgagaactgt
gggaagatgacttgttgggaacagacccagaagataacacatttgcccccaacactgaca
ttccacctcagacggttctcctccacaaatttctcagagactcagaaggtcatccaccca
ctgagttttcccaaaaacctgatcttttcaccagaacaagattggtgggactctgaagaa
cagaaatatgaactttttgcagtggttgctcacatggggacagccaactatggacattac
tgtgcctatatttgtaattctgctgatggcagatggttttgcttcaatgactccagtgtc
tgttgggggagaaatagcttatcttctggtttacatgaaggttga

DBGET integrated database retrieval system