KEGG   Sarcophilus harrisii (Tasmanian devil): 100928240Help
Entry
100928240         CDS       T02286                                 

Gene name
XIAP
Definition
(RefSeq) X-linked inhibitor of apoptosis, E3 ubiquitin protein ligase
  KO
K04725  
E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
Toxoplasmosis
HTLV-I infection
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100928240 (XIAP)
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    100928240 (XIAP)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100928240 (XIAP)
  Cellular commiunity
   04510 Focal adhesion
    100928240 (XIAP)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100928240 (XIAP)
   05222 Small cell lung cancer
    100928240 (XIAP)
  Infectious diseases
   05166 HTLV-I infection
    100928240 (XIAP)
   05145 Toxoplasmosis
    100928240 (XIAP)
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100928240 (XIAP)
Ubiquitin system [BR:shr04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100928240 (XIAP)
Mitochondrial biogenesis [BR:shr03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    100928240 (XIAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
X
AA seq 488 aa AA seqDB search
MTSKACVPPDINQDENFVEEKNRLQTFANFPSSSPVSASTLARAGFIYTGEGDTVKCFSC
HAAVDRWQFGDSAVGRHRKVSPNCGFINGFCLDRNAPQVPNPIAPNCPYRVENCSVNLSH
FVLERPLETYKEYLLRRGQVIDVADTIFPRNPAMCSEEARLRSFRNWPEYIHLTPEELAS
AGLYYLGIDDQVQCFCCGGKLKNWEPCDRAMSEHRRHFPKCFFVLGRDVGNTPIKSTASL
DRSCPNPTYIPKNPAMADYEARLLSFATWVFSINKEQLAKAGFYAIGDRDKVTCFHCGGG
LSDWRPTEDPWEQHAKWYPGCKFLLEKKGQEYINDIHLKNSLDNSVASFGKRPSVTREIG
YIVLESPLVQDAMRMGFSFYEVTKTMEEKVKATGSNYQSLEVLVADLVNAEEARTRGASS
SSQKEISTEEQLRRLQEEKLCKICMDENIAVVFIPCGHLVTCKSCAEVIDKCPMCYTVIT
FKQKIFMS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacttctaaagcctgtgtgcctccagatatcaatcaagatgaaaattttgttgaggaa
aagaatagattacaaacatttgctaattttccgagtagtagcccagtttcagcatcaaca
ctggcacgagcaggttttatctatactggtgaaggagatactgtgaagtgctttagctgt
catgcagctgtagatagatggcagtttggagactcggcagttggaaggcataggaaagtt
tctccaaactgtggatttattaatggtttttgtttggacagaaatgctccacaggttcca
aatcccattgccccaaactgtccgtatagagttgaaaattgttcagtgaatttaagtcat
tttgttttggagaggccccttgaaacttacaaggaatatcttttgagaagagggcaggtc
attgatgtagcagataccatattcccaaggaatcctgctatgtgcagtgaagaagctaga
ctgagatcttttcgtaattggccagagtatattcaccttaccccagaagagttagcaagc
gctggactctattacttgggtattgatgatcaagtgcagtgtttttgctgtgggggcaaa
ttaaagaattgggaaccatgtgatcgggcaatgtctgaacacaggaggcatttccctaag
tgtttttttgttttgggacgggatgttggtaatactccaattaaaagtaccgccagtctt
gataggagttgtccaaacccaacctatatcccaaagaatccagctatggcagattatgaa
gcacgactcctttcttttgcaacatgggtattctcgattaacaaggagcagcttgcaaaa
gctggattttatgctatcggtgaccgtgataaagtaacatgctttcattgtggaggtgga
cttagtgattggagacccactgaagacccttgggagcaacatgctaagtggtatccagga
tgcaaatttctgttagaaaagaagggccaggaatatatcaacgatattcatttaaagaat
tcacttgacaattctgtggcatcatttggcaaaagaccatcagtaactagagaaattggt
tatattgtgttagaaagtcctttggtacaagatgcaatgcgaatgggtttcagtttttat
gaggttacaaaaaccatggaagaaaaggtaaaagcgactggaagcaactatcaatcactt
gaggttctagtagcagatctagtgaatgctgaggaagcacgtacaagaggagcatcaagt
tcatcacagaaagagattagtactgaagaacagctcaggcgtctgcaagaggaaaagttg
tgtaagatctgcatggatgagaacattgctgtcgttttcatcccttgtggacatctggtt
acttgtaaatcctgtgctgaagtaattgacaaatgtccgatgtgttatactgtcattact
ttcaagcaaaaaattttcatgtcctaa

DBGET integrated database retrieval system