KEGG   Sarcophilus harrisii (Tasmanian devil): 100928252Help
Entry
100928252         CDS       T02286                                 

Gene name
HADHA
Definition
(RefSeq) trifunctional enzyme subunit alpha, mitochondrial
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00062  Fatty acid elongation
shr00071  Fatty acid degradation
shr00280  Valine, leucine and isoleucine degradation
shr00310  Lysine degradation
shr00380  Tryptophan metabolism
shr00410  beta-Alanine metabolism
shr00640  Propanoate metabolism
shr00650  Butanoate metabolism
shr01040  Biosynthesis of unsaturated fatty acids
shr01100  Metabolic pathways
shr01200  Carbon metabolism
shr01212  Fatty acid metabolism
Module
shr_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
shr_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
shr_M00085  Fatty acid biosynthesis, elongation, mitochondria
shr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100928252 (HADHA)
   00650 Butanoate metabolism
    100928252 (HADHA)
  Lipid metabolism
   00062 Fatty acid elongation
    100928252 (HADHA)
   00071 Fatty acid degradation
    100928252 (HADHA)
   01040 Biosynthesis of unsaturated fatty acids
    100928252 (HADHA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100928252 (HADHA)
   00310 Lysine degradation
    100928252 (HADHA)
   00380 Tryptophan metabolism
    100928252 (HADHA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100928252 (HADHA)
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     100928252 (HADHA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100928252 (HADHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-GeneID: 100928252
NCBI-ProteinID: XP_023350364
Ensembl: ENSSHAG00000014112
Position
1
AA seq 763 aa AA seqDB search
MVVSRAIGSLCRLTASRARRFTGYSCRNFAQSSSVLTRTHVNYAVRENVAVVRINSPNSK
VNTLNKELQSDFLQVMNEIWSSDRIKSVVIISSKPGCFIAGADISMIAACKTAKEVTQLS
QEGQKMFEKLEKSPKPVVAAISGSCLGGGLELAIACQFRIATKDKKTILGTPEVLLGLLP
GAGGTQRLPKMVGIPAAFDMMLTGRNIRADRAKKMGLVDQLVEPLGPGLKLPEERTVEYL
EEIAVNFAKELADKQISGKKDKALIDKVTSYAMTFPFVRQLVYRKVEEKVQKQTKGLYPA
PLKIIDVVKTGIEHGGEAGYLSESQKFGELAMTKESKALIGLYHGQVLCKKNKFGPPQRT
VTQLCILGAGLMGAGIAQVSVDKGLKTILKDTSIVGLGRGQQQIFKGLDEKVKKKTLTSF
ERDSIYSNLTGQLDYQGFEKSDMVIEAVFEDLALKHSVLKEIESVVPAHCIFASNTSALP
ISEIASVSKRPEKVIGMHYFSPVDKMQLLEIITTDKTSQDTVASAVSVGLKQGKVIIVVK
DGPGFYTTRCLAPMMSEVIRILQEGIEPRKLDSLTTNFGFPVGAATLVDEVGVDVAQHVS
EELGKAFGERFGGGNQELLKQMVNRGFLGRKSGKGFYIYQTGTKSKSLNSGMDEILTGLK
VSPRSEVSTPEEIQYRLITRFVNEAVMCLQEGILASPAEGDIGAVFGLGFPPCLGGPFRF
SDLYGAQKLVDRMKRYEAIYGKQFSPCQLLIDHANNPSKKFYP
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atggtggtctcccgggcaattggcagcctttgccgcctgacggcttcccgcgcccgccgc
ttcactggttatagctgccggaactttgctcagtcctcttctgtgttaactagaacccat
gttaactatgcagtcagagaaaatgtagcagttgtgcgaattaactctcccaattcaaag
gtaaacactttgaataaagagctgcagtcagactttttacaagtgatgaatgaaatatgg
tctagtgatagaatcaaaagtgttgtcattatctcttcaaagccaggctgctttattgct
ggtgctgatatcagcatgatagctgcttgtaagactgctaaggaggtaacacagttatca
caagagggacaaaaaatgttcgagaaacttgagaagtctccaaagcctgttgtggctgcc
atcagtgggtcctgtctgggaggaggacttgagcttgccattgcgtgtcaattcagaata
gcaacaaaagacaaaaagacaatattggggacccctgaagtgttactaggtttattgcca
ggagcaggaggcactcaaaggctcccaaagatggttggaattcctgctgcatttgacatg
atgctgactggtagaaacattcgtgcagatagagcaaagaaaatgggtctggttgaccag
ttggtggaacctctaggaccaggtttgaaactaccagaagaaagaactgttgaataccta
gaagaaatagcagttaactttgcaaaagaactggctgataagcagatctctgggaagaag
gataaggcactgattgataaggtgacatcatatgccatgacttttccatttgtgaggcaa
ctcgtgtacagaaaagttgaagagaaggtacagaaacaaaccaaaggtctttatccagct
ccactaaaaataattgatgtagtgaagactggaattgaacatgggggtgaagctggctac
ctctctgaatcccagaaatttggtgaacttgcgatgactaaagaatctaaggctttaatt
ggtctctaccatggtcaggttctttgcaagaagaataagtttggacctccacagaggact
gttacgcaactatgcattcttggagctggtcttatgggagctggcattgcccaagtctct
gtggataaaggactgaagaccatactcaaagatacttcaatagtgggtttaggaagagga
cagcagcaaattttcaaagggttggatgaaaaagtgaagaagaagacactaacatcattt
gaaagagattctatttatagcaacctgactgggcaacttgattatcagggatttgaaaaa
tctgacatggtgattgaagccgtttttgaggaccttgctcttaaacactcagttctaaag
gagattgaatcagtagttccagctcattgtatttttgctagtaacacatcagctctccca
atcagtgaaattgcttctgttagcaaaagacctgaaaaggttattggaatgcactacttt
tctcctgtggacaagatgcagctattagagatcatcacaacagacaaaacttcccaggat
acagttgcgtctgcagtctcagttggtctgaagcagggaaaagtgatcattgtagttaag
gatggaccagggttctataccaccaggtgtcttgcacccatgatgtctgaagtcattcga
attctacaggaaggtattgagcccagaaagttggatagcctgactacaaactttggcttc
cctgtgggtgctgccacactagtagatgaagttggtgttgatgtagctcaacatgtatca
gaagagctgggcaaagcctttggggaacgctttggtggtggaaaccaagaactgctgaaa
caaatggtcaacagaggtttcttgggtcgcaaatctggaaaggggttttatatctaccag
acaggaacgaaaagcaagagtttgaattctggcatggatgaaattctgacaggtctgaag
gtctctcctcggtccgaagtctctaccccagaagagatccagtacagattaataacaaga
tttgtgaatgaagcagtcatgtgtctccaagaagggattctggcttctcctgcagaggga
gacattggggcagtctttggccttggctttccaccttgccttggaggtcccttccgtttc
tcagatctgtatggtgctcagaagttggtagaccggatgaagagatatgaagcaatctac
ggaaagcaattcagtccttgccagttactgattgaccatgcaaacaaccctagcaaaaag
ttttatccttga

DBGET integrated database retrieval system