KEGG   Sarcophilus harrisii (Tasmanian devil): 100928252Help
Entry
100928252         CDS       T02286                                 

Gene name
HADHA
Definition
hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:shr01200]
Metabolism; Overview; Fatty acid metabolism [PATH:shr01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:shr00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:shr00650]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:shr00062]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:shr00071]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:shr01040]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:shr00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:shr00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:shr00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:shr00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 782 aa AA seqDB search
MYEFLEVAVPRIVEEMESEMRWLAFGSKLDLRYHIDILFSIGYSCRNFAQSSSVLTRTHV
NYAVRENVAVVRINSPNSKVNTLNKELQSDFLQVMNEIWSSDRIKSVVIISSKPGCFIAG
ADISMIAACKTAKEVTQLSQEGQKMFEKLEKSPKPVVAAISGSCLGGGLELAIACQFRIA
TKDKKTILGTPEVLLGLLPGAGGTQRLPKMVGIPAAFDMMLTGRNIRADRAKKMGLVDQL
VEPLGPGLKLPEERTVEYLEEIAVNFAKELADKQISGKKDKALIDKVTSYAMTFPFVRQL
VYRKVEEKVQKQTKGLYPAPLKIIDVVKTGIEHGGEAGYLSESQKFGELAMTKESKALIG
LYHGQVLCKKNKFGPPQRTVTQLCILGAGLMGAGIAQVSVDKGLKTILKDTSIVGLGRGQ
QQIFKGLDEKVKKKTLTSFERDSIYSNLTGQLDYQGFEKSDMVIEAVFEDLALKHSVLKE
IESVVPAHCIFASNTSALPISEIASVSKRPEKVIGMHYFSPVDKMQLLEIITTDKTSQDT
VASAVSVGLKQGKVIIVVKDGPGFYTTRCLAPMMSEVIRILQEGIEPRKLDSLTTNFGFP
VGAATLVDEVGVDVAQHVSEELGKAFGERFGGGNQELLKQMVNRGFLGRKSGKGFYIYQT
GTKSKSLNSGMDEILTGLKVSPRSEVSTPEEIQYRLITRFVNEAVMCLQEGILASPAEGD
IGAVFGLGFPPCLGGPFRFSDLYGAQKLVDRMKRYEAIYGKQFSPCQLLIDHANNPSKKF
YP
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaattcctagaagtagctgtacccagaatagttgaggaaatggagtcagaaatg
agatggctagcctttgggagcaaacttgatcttaggtatcatattgatattttgttttca
ataggttatagctgccggaactttgctcagtcctcttctgtgttaactagaacccatgtt
aactatgcagtcagagaaaatgtagcagttgtgcgaattaactctcccaattcaaaggta
aacactttgaataaagagctgcagtcagactttttacaagtgatgaatgaaatatggtct
agtgatagaatcaaaagtgttgtcattatctcttcaaagccaggctgctttattgctggt
gctgatatcagcatgatagctgcttgtaagactgctaaggaggtaacacagttatcacaa
gagggacaaaaaatgttcgagaaacttgagaagtctccaaagcctgttgtggctgccatc
agtgggtcctgtctgggaggaggacttgagcttgccattgcgtgtcaattcagaatagca
acaaaagacaaaaagacaatattggggacccctgaagtgttactaggtttattgccagga
gcaggaggcactcaaaggctcccaaagatggttggaattcctgctgcatttgacatgatg
ctgactggtagaaacattcgtgcagatagagcaaagaaaatgggtctggttgaccagttg
gtggaacctctaggaccaggtttgaaactaccagaagaaagaactgttgaatacctagaa
gaaatagcagttaactttgcaaaagaactggctgataagcagatctctgggaagaaggat
aaggcactgattgataaggtgacatcatatgccatgacttttccatttgtgaggcaactc
gtgtacagaaaagttgaagagaaggtacagaaacaaaccaaaggtctttatccagctcca
ctaaaaataattgatgtagtgaagactggaattgaacatgggggtgaagctggctacctc
tctgaatcccagaaatttggtgaacttgcgatgactaaagaatctaaggctttaattggt
ctctaccatggtcaggttctttgcaagaagaataagtttggacctccacagaggactgtt
acgcaactatgcattcttggagctggtcttatgggagctggcattgcccaagtctctgtg
gataaaggactgaagaccatactcaaagatacttcaatagtgggtttaggaagaggacag
cagcaaattttcaaagggttggatgaaaaagtgaagaagaagacactaacatcatttgaa
agagattctatttatagcaacctgactgggcaacttgattatcagggatttgaaaaatct
gacatggtgattgaagccgtttttgaggaccttgctcttaaacactcagttctaaaggag
attgaatcagtagttccagctcattgtatttttgctagtaacacatcagctctcccaatc
agtgaaattgcttctgttagcaaaagacctgaaaaggttattggaatgcactacttttct
cctgtggacaagatgcagctattagagatcatcacaacagacaaaacttcccaggataca
gttgcgtctgcagtctcagttggtctgaagcagggaaaagtgatcattgtagttaaggat
ggaccagggttctataccaccaggtgtcttgcacccatgatgtctgaagtcattcgaatt
ctacaggaaggtattgagcccagaaagttggatagcctgactacaaactttggcttccct
gtgggtgctgccacactagtagatgaagttggtgttgatgtagctcaacatgtatcagaa
gagctgggcaaagcctttggggaacgctttggtggtggaaaccaagaactgctgaaacaa
atggtcaacagaggtttcttgggtcgcaaatctggaaaggggttttatatctaccagaca
ggaacgaaaagcaagagtttgaattctggcatggatgaaattctgacaggtctgaaggtc
tctcctcggtccgaagtctctaccccagaagagatccagtacagattaataacaagattt
gtgaatgaagcagtcatgtgtctccaagaagggattctggcttctcctgcagagggagac
attggggcagtctttggccttggctttccaccttgccttggaggtcccttccgtttctca
gatctgtatggtgctcagaagttggtagaccggatgaagagatatgaagcaatctacgga
aagcaattcagtccttgccagttactgattgaccatgcaaacaaccctagcaaaaagttt
tatccttga

DBGET integrated database retrieval system