KEGG   Sarcophilus harrisii (Tasmanian devil): 100928316Help
Entry
100928316         CDS       T02286                                 

Gene name
CLOCK
Definition
clock homolog (mouse)
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Circadian rhythm
Dopaminergic synapse
Herpes simplex infection
Class
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:shr04728]
Organismal Systems; Environmental adaptation; Circadian rhythm [PATH:shr04710]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:shr05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 886 aa AA seqDB search
METPASAPAGVSAWVCYRCVMHGSVPAGGCVRVWYKRVVDTHGCAGSVRSCLCARMLQVH
YTRVCLQVSVTDGHTCARSHANIHVYCAHLHASVTLSVCQRVRDTRVCVLVHECCVHITC
GTVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKEITAQSDAS
EIRQDWKPTFLSNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTPLLEHLPSDLVDQSI
FNFIPEGEHSEVYKMLSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPPTYEFVK
FIGNFKSLNNVSSSSHNGFEGTIQRSHRPSYEDRICFVATVRLATPQFIKEMCTVEEPNE
EFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKG
KSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTVVSYAEVRAERRRELGIKES
LPEIAADKSQDSGSDNRINTVSLKEALERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTK
IATDNSTPPRQHLPGHEKIAQRRSSFSSQSLNSQSVGQSLAQPMMSQATALHIQQGMSQP
MFQFSAQLGAMQHLKDQLEQRTRMIEANIHRQQEELRKIQEQLQMVHGQGLQMFLQQSSP
GLNFGSVQLSSGNSSNMQQLTPINMQSQVVQANQIQSGLNTGHIGSSQHMMQQQSLQSPA
TQQTQPNVLSGHNQQTSLSSQTQSTLTAPLYNTMVISQPTTGNIVQIPSSIPQNNNQGAA
VTTFTQDRQIRFSQGQQLVTKLVTAPVACGAVMVPSTMFMGQVVTAYPTFAAQQQQPQTL
SITQQQQQQQQQQPSQQEQQLTTIQQSSQAQLTQPSQQFLQIMLLT
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atggagacacccgcgagcgcgcctgcaggtgtgtctgcatgggtgtgctacaggtgtgtg
atgcacgggagtgtgcccgcaggtggctgtgtgcgcgtatggtacaagcgtgtggtggac
acacacgggtgcgcgggcagcgtgcgttcctgtctgtgtgcgcgtatgttgcaggtgcat
tacacacgagtgtgcctgcaggtgtctgttaccgacggacacacgtgtgcccgcagccat
gccaacatacatgtatattgtgcccacctgcatgccagcgtgaccctgtctgtgtgccag
cgcgtccgtgacactcgtgtctgtgttcttgtgcatgaatgctgcgtgcacataacatgt
ggcacagtatctagaaacaaatctgaaaagaagcggagagatcagtttaatgttctcatt
aaagaattgggatctatgcttcctggtaatgctcggaagatggacaaatctactgtacta
cagaaaagcattgattttttaaggaagcacaaagaaattactgcacagtcagatgccagt
gaaattcgacaggactggaaaccaacattccttagtaatgaagagtttacacaattaatg
ttagaggctcttgatggtttttttttagcaatcatgacagatggaagcataatatatgta
tctgaaagtgtaactccattacttgaacatttaccatctgatcttgtggatcaaagcata
tttaactttatcccagaaggagaacattcagaagtttataaaatgttgtcaactcatctt
ctggaaagtgattcattaacaccagagtatctaaaatcaaaaaatcagcttgaattctgt
tgccacatgctccgaggaacaatagatccaaaagaaccacctacatatgaatttgtgaag
tttataggaaatttcaaatctttgaacaatgtatccagttcatcacacaatggttttgaa
ggaaccatacagcgatcccataggccttcctatgaagacagaatttgttttgtagctact
gttaggttagctacacctcagttcattaaggaaatgtgcactgttgaagagcccaatgaa
gagttcacatccagacatagtttagaatggaaatttctcttcctagatcacagggctcct
cccataataggatatttaccatttgaagttctggggacatcagggtatgattattatcat
gtggatgacttagaaaatttggcaaaatgccatgaacatttaatgcagtatgggaaaggc
aagtcctgttattataggttcctgacaaaagggcaacagtggatttggcttcaaactcat
tactatatcacttatcatcagtggaattcaaggccagagtttattgtttgtacgcacaca
gtagtaagttatgcagaagttagggctgaaaggcgacgtgagcttggcattaaggagtcc
cttcctgagatagcagctgataaaagccaagactctggatctgataatcgtattaacact
gttagtctcaaagaagcattagaaagatttgatcacagcccaactccttctgcttcatcc
aggagttcacggaaatcctctcatactgcagtgtcagatccttcctcaacaccaacaaag
atagcaacagataatagcactcctcccagacaacatttacctggacatgaaaaaatagct
caaaggaggtcatcatttagtagtcagtccctaaattcccaatctgttggtcagtcttta
gcacagccaatgatgtctcaagctacagctttacatattcaacaaggaatgtcacagccc
atgtttcagttttcagctcagttgggagccatgcagcacctaaaagatcagctggaacaa
cggacccgaatgattgaggcaaatattcaccgacaacaagaagaactcagaaaaatccaa
gaacaattacagatggtccatggtcaagggctacaaatgtttttacagcagtcatcccct
ggattgaattttggttctgttcaactgtcttctggaaattcatcaaatatgcaacaactt
actcctataaacatgcaaagtcaagttgttcaggctaatcagattcaaagtggattaaat
actggacatattggttcttctcagcatatgatgcaacaacagtctttacaaagtccagca
actcagcaaactcaaccaaacgttctcagtggacacaatcaacaaacctctctttccagt
cagactcaaagcacgctgactgctccactgtacaacactatggtaatttctcagccaaca
acgggaaacatagtccagattccatctagcataccacaaaacaataatcagggtgctgca
gtaactactttcacccaggacagacagataagattttctcaaggtcaacaactggtgacc
aaattagttactgctcctgttgcctgtggggcagttatggtacctagtactatgtttatg
ggtcaggtggtaactgcctatcccacttttgctgcacaacaacagcagccacaaacgttg
tcaatcacacagcagcagcagcagcaacagcagcaacaaccaagccagcaggaacagcag
ctaactaccattcagcaatcatctcaggctcagctgactcagccatcacagcagttctta
cagataatgttactgacctag

DBGET integrated database retrieval system