KEGG   Sarcophilus harrisii (Tasmanian devil): 100928316Help
Entry
100928316         CDS       T02286                                 

Gene name
CLOCK
Definition
(RefSeq) circadian locomoter output cycles protein kaput
  KO
K02223  circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04710  Circadian rhythm
shr04728  Dopaminergic synapse
shr05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:shr00001]
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    100928316 (CLOCK)
  Environmental adaptation
   04710 Circadian rhythm
    100928316 (CLOCK)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100928316 (CLOCK)
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100928316 (CLOCK)
Transcription factors [BR:shr03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100928316 (CLOCK)
Chromosome [BR:shr03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100928316 (CLOCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_11 PAS_3 HLH PAS PAS_9
Motif
Other DBs
NCBI-GeneID: 100928316
NCBI-ProteinID: XP_023361770
Ensembl: ENSSHAG00000005555
Position
6
AA seq 869 aa AA seqDB search
MEKFVCHITVSRGPLKDPDTIVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQ
KSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAIMTDGSIIYVS
ESVTPLLEHLPSDLVDQSIFNFIPEGEHSEVYKMLSTHLLESDSLTPEYLKSKNQLEFCC
HMLRGTIDPKEPPTYEFVKFIGNFKSLNNVSSSSHNGFEGTIQRSHRPSYEDRICFVATV
RLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHV
DDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTV
VSYAEVRAERRRELGIKESLPEIAADKSQDSGSDNRINTVSLKEALERFDHSPTPSASSR
SSRKSSHTAVSDPSSTPTKIATDNSTPPRQHLPGHEKIAQRRSSFSSQSLNSQSVGQSLA
QPMMSQATALHIQQGMSQPMFQFSAQLGAMQHLKDQLEQRTRMIEANIHRQQEELRKIQE
QLQMVHGQGLQMFLQQSSPGLNFGSVQLSSGNSSNMQQLTPINMQSQVVQANQIQSGLNT
GHIGSSQHMMQQQSLQSPATQQTQPNVLSGHNQQTSLSSQTQSTLTAPLYNTMVISQPTT
GNIVQIPSSIPQNNNQGAAVTTFTQDRQIRFSQGQQLVTKLVTAPVACGAVMVPSTMFMG
QVVTAYPTFAAQQQQPQTLSITQQQQQQQQQQPSQQEQQLTTIQQSSQAQLTQPSQQFLQ
VIPSMLNLSSTYLILGNRLLWINRVNFFKISCISKDLTFLFFPKNVSVLVYLKSSNSDKL
LLFVIVTLFPLLNANCKIFKYKVTHILIQ
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atggagaagtttgtgtgccatattacggtcagtaggggacccctaaaggatcctgacact
atagtatctagaaacaaatctgaaaagaagcggagagatcagtttaatgttctcattaaa
gaattgggatctatgcttcctggtaatgctcggaagatggacaaatctactgtactacag
aaaagcattgattttttaaggaagcacaaagaaattactgcacagtcagatgccagtgaa
attcgacaggactggaaaccaacattccttagtaatgaagagtttacacaattaatgtta
gaggctcttgatggtttttttttagcaatcatgacagatggaagcataatatatgtatct
gaaagtgtaactccattacttgaacatttaccatctgatcttgtggatcaaagcatattt
aactttatcccagaaggagaacattcagaagtttataaaatgttgtcaactcatcttctg
gaaagtgattcattaacaccagagtatctaaaatcaaaaaatcagcttgaattctgttgc
cacatgctccgaggaacaatagatccaaaagaaccacctacatatgaatttgtgaagttt
ataggaaatttcaaatctttgaacaatgtatccagttcatcacacaatggttttgaagga
accatacagcgatcccataggccttcctatgaagacagaatttgttttgtagctactgtt
aggttagctacacctcagttcattaaggaaatgtgcactgttgaagagcccaatgaagag
ttcacatccagacatagtttagaatggaaatttctcttcctagatcacagggctcctccc
ataataggatatttaccatttgaagttctggggacatcagggtatgattattatcatgtg
gatgacttagaaaatttggcaaaatgccatgaacatttaatgcagtatgggaaaggcaag
tcctgttattataggttcctgacaaaagggcaacagtggatttggcttcaaactcattac
tatatcacttatcatcagtggaattcaaggccagagtttattgtttgtacgcacacagta
gtaagttatgcagaagttagggctgaaaggcgacgtgagcttggcattaaggagtccctt
cctgagatagcagctgataaaagccaagactctggatctgataatcgtattaacactgtt
agtctcaaagaagcattagaaagatttgatcacagcccaactccttctgcttcatccagg
agttcacggaaatcctctcatactgcagtgtcagatccttcctcaacaccaacaaagata
gcaacagataatagcactcctcccagacaacatttacctggacatgaaaaaatagctcaa
aggaggtcatcatttagtagtcagtccctaaattcccaatctgttggtcagtctttagca
cagccaatgatgtctcaagctacagctttacatattcaacaaggaatgtcacagcccatg
tttcagttttcagctcagttgggagccatgcagcacctaaaagatcagctggaacaacgg
acccgaatgattgaggcaaatattcaccgacaacaagaagaactcagaaaaatccaagaa
caattacagatggtccatggtcaagggctacaaatgtttttacagcagtcatcccctgga
ttgaattttggttctgttcaactgtcttctggaaattcatcaaatatgcaacaacttact
cctataaacatgcaaagtcaagttgttcaggctaatcagattcaaagtggattaaatact
ggacatattggttcttctcagcatatgatgcaacaacagtctttacaaagtccagcaact
cagcaaactcaaccaaacgttctcagtggacacaatcaacaaacctctctttccagtcag
actcaaagcacgctgactgctccactgtacaacactatggtaatttctcagccaacaacg
ggaaacatagtccagattccatctagcataccacaaaacaataatcagggtgctgcagta
actactttcacccaggacagacagataagattttctcaaggtcaacaactggtgaccaaa
ttagttactgctcctgttgcctgtggggcagttatggtacctagtactatgtttatgggt
caggtggtaactgcctatcccacttttgctgcacaacaacagcagccacaaacgttgtca
atcacacagcagcagcagcagcaacagcagcaacaaccaagccagcaggaacagcagcta
actaccattcagcaatcatctcaggctcagctgactcagccatcacagcagttcttacag
gtcattccttctatgttaaatttatccagtacatatttaattttaggtaacagattatta
tggataaacagggttaacttttttaaaataagctgtatctccaaagatctaacttttcta
tttttcccaaaaaatgtctctgttctagtgtaccttaagtctagtaatagtgacaaacta
ttactgtttgtcatagtgaccctttttcccctattaaatgctaattgcaaaatatttaaa
tataaggtgacccacattttaatacaataa

DBGET integrated database retrieval system